KEGG   Streptosporangium roseum: Sros_7268Help
Entry
Sros_7268         CDS       T01137                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sro  Streptosporangium roseum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sros_7268
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sros_7268
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sros_7268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8016284..8017408)
Genome map
AA seq 374 aa AA seqDB search
MDSVRDRIRTASRLVVKVGSSSLTTAQGMIDVDRVDALVDVLAARRGTGTQIVLVSSGAI
AAGLGPLGLSSRPRDLATQQAAASVGQGVLVARYTSSFARYGLRVGQVLLTADDMMRRSH
HVNAQRTLGRLLELGIVPVVNENDTVATDEIRFGDNDRLAALVAHLTRADALVLLSDVDA
LYDGDPRRPGARRLGDVRGPEDLVGVELGKGGAVGTGGMVTKVQAARIATGAGVPVVLTA
AAHAAQALAGVDIGTCFHPDGRHPGTRLLWLAHATTGRGRLHLDPGAVEAVVGRRKSLLP
AGVTAVEGDFAAGDPVDLCGPLGRVVARGLVNFDAVEIPGLLGRSTRELATSLGPEYERE
LIHRDDIVILESHH
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggactctgtgcgcgatcggatccgtacggcctcacgtctggtcgtgaaggtgggttcg
tcctcgctcaccaccgcgcaggggatgatcgacgtcgaccgggtggacgctctggtcgac
gtgctcgccgcccggcgcgggaccggcacgcagatcgtgctggtctcctccggcgcgatc
gcggccggcctcggcccgctgggcctgtccagccggccgcgtgacctcgccacccagcag
gccgccgcctcggtcggccagggggtgctggtcgcccgatacacctcctccttcgcccgg
tacggcctgcgcgtgggccaggtgctgctgaccgccgacgacatgatgcgccgctcgcac
cacgtcaacgcccagcgcacgctgggccggctgctggagctgggcatcgtcccggtggtc
aacgagaacgacaccgtggccaccgacgagatccgcttcggtgacaacgaccggctcgcc
gccctggtggcgcacctgacccgtgccgacgcgctggtgctcctgtccgacgtggacgcc
ctctacgacggcgatccccgccgtcccggcgcccgcaggctcggcgacgtgcgcggcccg
gaggacctggtgggggtcgagctcggcaagggcggcgcggtcggcaccggcggaatggtc
accaaggtgcaggcggccaggatcgccaccggagccggcgtgcccgtggtcctgaccgcc
gccgcgcacgccgcccaggccctcgcgggtgtcgacatcggcacctgcttccatccggac
ggccgccaccccggcacccgcctgctctggctggcccacgccaccaccggccgcgggcgg
ctccacctggatcccggtgcggtcgaggccgtggtgggccgccgcaagtcgctgctgccc
gccggggtcaccgctgtggagggggacttcgccgccggggacccggtggacctgtgcgga
ccgctgggccgggtggtcgcccggggactggtcaacttcgacgcggtggagatccccggt
ctgctcggccgttccacccgcgagctggccaccagcctcggtccggaatatgaacgcgag
ctgatccaccgtgacgacatcgtcatactggagtcccaccactag

DBGET integrated database retrieval system