KEGG   Streptosporangium roseum: Sros_7462Help
Entry
Sros_7462         CDS       T01137                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sro  Streptosporangium roseum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sro00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sro00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8251118..8252467
Genome map
AA seq 449 aa AA seqDB search
MNERPEVVPALQEWTGGTGEFRLGPESRVVCADERLGSRLAGELGIGHATEGPGDVVLEI
VPSGGRAEGYRIEAAPGRVTITAPTARGLFYGTRTLVQILRTGAVPCGVAHDWPDYPVRG
YMLDVGRRYVTPELIHRLVRLMGRYKLNELQLHLNDNEIKAPDGDWGKALHGFRLRSPAF
PGLAPEESYSRDDWDGFEELAAAHAITLVPEIDAPAHSRAFISFDPSVGHDGGDSDHLDL
ANPAATELVKAVFTEFVPWFRGPAVHFGADEYYQSKALWKQFFNNMAAHVRSLGKQPRAW
GGFTRLSPTGDTAGFDPDVVINSWNNGFYGPEGAREDSYALINSNDDLLYIVPEADYYHG
AGLDAEWLYDHWEPHVFADGQSLDPGDPRLLGAMPALWNDLVRADYTEERMYELIEHSLG
VLAQKMWSGAKAGLPYRDFVRLLQRLDSW
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcggcccgaagtcgtcccggccctgcaggaatggaccggcggcaccggcgag
ttccggctcggccccgagtcccgggtcgtctgcgccgacgagaggctcggcagccgcctc
gccggtgagctcggcatcggacacgccaccgaggggccgggagacgtcgtcctggagatc
gtcccctccggcggcagagccgagggctaccggatcgaagccgcgcccggccgcgtgacg
atcaccgcacccaccgctcgcggcctgttctacggaacccgcaccctcgtgcagatcctc
cgtaccggcgcggtcccgtgcggcgtggcccacgactggcccgactacccggtccgcggc
tacatgctcgacgtcggccgccgctacgtcacccccgagctcatccaccgcctcgtccgc
ctgatgggccgctacaagctcaacgagctgcagctccacctcaacgacaatgagatcaaa
gccccggacggagactggggcaaggctctgcacggcttccggctgcgctcgcccgccttc
cccggcctggcgccggaggagtcgtactcccgtgacgactgggacggcttcgaggaactc
gccgccgcccacgcgatcaccctcgtccccgagatcgacgccccggcccactcgcgcgcc
ttcatctccttcgacccctccgtgggccacgacggcggcgactccgaccacctcgacctg
gccaacccggccgcgaccgagctggtcaaggccgtgttcaccgagttcgtgccctggttc
cgcggaccggctgtgcacttcggggccgacgagtactaccagagcaaggcgttgtggaag
cagttcttcaacaacatggccgcgcatgtgcgctcgctcggcaagcagccccgcgcgtgg
ggcgggttcacccgcctgtccccgacgggtgacaccgccggattcgaccccgacgtggtg
atcaacagctggaacaacggcttctacggccccgagggggctcgcgaggactcctacgcc
ctgatcaacagcaatgacgacctgctctacatcgtccccgaggccgactactaccacggc
gccggcctcgacgccgagtggctctacgaccactgggagccgcacgtcttcgccgacggc
caatccctcgatccgggcgacccccgcctgctcggcgccatgccggcgctctggaacgac
ctggtcagagcggactacaccgaggagaggatgtacgagctcatcgagcacagcctgggc
gtgctcgcgcagaagatgtggagtggcgccaaggccgggttgccgtaccgggacttcgtc
cggttgctgcagaggttggactcctggtag

DBGET integrated database retrieval system