KEGG   Streptosporangium roseum: Sros_7485Help
Entry
Sros_7485         CDS       T01137                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sro  Streptosporangium roseum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sro00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8278103..8279620
Genome map
AA seq 505 aa AA seqDB search
MATRYVMSIDQGTTSTRCIVFDQRGHLVSVTQREHRQHFPRPGWVEHDAVEIWRNLERIG
PEALARAGIGPGQVVAVGIANQRETTVLWDRRTGVPVGRAVVWQDTRTDALVEELSRRPG
AEAVPERCGLPLAAYFSAPRIRWLLDHTPGLRERAESGEVLFGTMESWLIWNLTGGPDGG
VHVTDVTNASRTLLMDLTTLDWDDGLLAFFGVPRRMLPRIRPSTETYGTARRVFPGVRIA
AALGDQQAALFGQTCFASGEAKCTYGTGGFLLLNTGTTPVRSAHGLLTTVGYQVGREPAV
YALEGPIAVTGALVQWFRDGLGLISSAPEIETLARTVQDNGGCYIVPAFAGLFAPHWRSE
ARGVIVGLTSYVTKGHLARAVLEATAWQTREVVDAMNADSGLALRTLKVDGGMTADNLLM
QIVANVLDVPVVRPMAVETVSLGAAYAAGLAVGYWADLEGLRRNWHRAAQWSPHMDPRLR
TAEHDNWRRAVERALGWVRPVPGHR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcgttacgtgatgtccatcgaccagggcacgacgtcgacgcggtgcatcgtc
ttcgaccaacggggacatctcgtctcggtgacccagcgggagcaccgccagcactttccc
cggccgggatgggtcgagcacgacgccgtcgagatctggcgcaacctggagcgcatcggg
cccgaggcactcgcccgggccggcataggccccgggcaggtggtggccgtcggcatcgcc
aaccagcgggagacgaccgtcctgtgggacaggcggaccggggtccccgtcggccgggcc
gtcgtgtggcaggacacgcggaccgacgccctggtggaggagctctcccgccggccgggc
gcggaggcggtgccggaacgctgcggcctgccgctggccgcctacttctccgcgccgcgc
atccggtggctcctcgaccacaccccgggcctgcgggagcgcgccgaaagcggcgaggtg
ctcttcgggacgatggagagctggctcatctggaacctgaccggcgggcccgacggcggc
gtccacgtcaccgacgtcaccaacgccagccgcaccctgctgatggacctgaccaccctg
gactgggacgacgggctcctcgccttcttcggcgtcccccgccggatgctgccgcggatc
cggccctcgacggagacctacggcaccgcccggcgggtgttccccggcgtgcgcatcgcc
gccgcgctcggcgaccagcaggcggcgctgttcgggcagacctgcttcgcctccggcgag
gccaagtgcacctacggcacgggcggcttcctgctgctcaacaccgggaccacgccggtc
cgctccgcccacggcctgctgacgaccgtcggctaccaggtgggccgggaaccggcggtc
tacgcgctggaggggccgatcgcggtcaccggtgcgctcgtgcagtggttccgcgacggg
ctcgggctcatcagcagcgcgccggagatcgagacgctggcccggaccgtgcaggacaac
gggggatgttacatcgtcccggccttcgccgggctcttcgcaccgcactggcgcagcgag
gcccgcggggtcatcgtggggctgacctcctacgtcaccaaggggcatctggcgcgggcc
gtgctggaggcgaccgcgtggcagacccgcgaggtggtcgacgccatgaacgccgactcg
ggcctggcgttgcggacgctgaaggtcgacggcggcatgaccgccgacaacctcctcatg
cagatcgtcgccaacgtgctggacgtgcccgtcgtgcgtcccatggcggtggagaccgtg
tcgctgggcgcggcctacgcggccggtctcgccgtcgggtactgggccgacctcgaaggg
ctccggcgcaactggcaccgggccgcgcagtggagcccgcacatggacccgcggctgcgc
acggccgagcacgacaactggcggcgggccgtcgaacgcgcgctgggctgggtcaggccg
gtgcccggccaccgctga

DBGET integrated database retrieval system