KEGG   Streptosporangium roseum: Sros_7708Help
Entry
Sros_7708         CDS       T01137                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sro  Streptosporangium roseum
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sro00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8509420..8510067
Genome map
AA seq 215 aa AA seqDB search
MLLAEQRRLLCEYGRRAAETGLVVGTAGNLSARAGDLIAVTPSGVSLDRLEPEACPVIDV
EGHLVEGELQPSSETPMHLAVYTTTDARAVVHTHSTFGTVVATTMTELPPIHYNTLLLGG
TVRVADYATFGTPELAANVRAALKDRRAALLANHGGVTVGDDLHKAFEATRLLEWLCEVY
VRAKSVGEPRVLTEEQLSAVVQRAFSPPRFPRRED
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttgctggcggagcagcgtcgtctgctgtgtgaatacggccgcagggccgcggagacc
ggactcgtggtcggcactgccggaaacctgagcgcgcgcgccggcgatctgatcgcggtg
acgcccagcggggtctccctggaccggctggaacccgaggcctgcccggtgatcgacgtc
gagggccacctggtcgagggagagctgcagccgtcctccgagacgcccatgcacctggcg
gtctatacgaccaccgacgcgcgggccgtggtgcacacccactccaccttcggcaccgtg
gtcgccacgaccatgaccgagctgccgccgatccactacaacacgctgctgctcggcggg
accgtcagggtcgccgactacgccaccttcggcacccccgagctggccgccaacgtcagg
gccgccctgaaggacaggcgggccgcgctgctggccaaccacggcggggtgaccgtcggc
gacgacctgcacaaggccttcgaggcgacccggctgctggaatggctctgcgaggtctac
gtgcgggccaagtccgtcggcgagccccgggtgctcaccgaggaacagctctccgcggtg
gtccagcgcgccttctcccctccccgtttcccccgtcgcgaggactga

DBGET integrated database retrieval system