KEGG   Streptosporangium roseum: Sros_8169Help
Entry
Sros_8169         CDS       T01137                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sro  Streptosporangium roseum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sros_8169
Enzymes [BR:sro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sros_8169
Exosome [BR:sro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sros_8169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9005889..9008246
Genome map
AA seq 785 aa AA seqDB search
MNAHLDLERLAGGAHHDPHSILGAHPGPGGVTVRVLRPLAEKVQVVVDGQVHDMEHVAHG
VFAVTIPGLDKVPDYRFRVTYAGAEPYEMADPYRHWPTLGEVDLHLIGEGRHERLWEVLG
ARVMRHEDVEGTAFAVWAPNARGIRVIGDFNHWDGTAYPMRSLGRSGVWELFIPGLGEGD
RYKFGVLGADGVWRAKADPMARRTETPPATASVIDRSDYDWQDDEWMRRRASHNALEAPM
STYEVHLGSWRPGLSYRQLATELVDYVVDMGFTHVEFMPVAEHPFGGSWGYQVTSYYAPT
ARFGTPDEFRHLVDRLHEAGIGVVVDWVPAHFPMDDWALARFDGTPLYEHADPARGEHPD
WGTYVFDFGRREVRNFLVANAVYWLREFHIDGLRVDAVASMLYLDYSRREGEWTPNEYGG
RENLDAVEFLKEMNMVSYRDQPGIITVAEESTAWPGVSRPVHLGGLGFGFKWNMGWMHDT
LAYLKHEPIFRQYHHHQMTFSLMYAYSENFVLPLSHDEVVHGKGSLLGKMPGDEWQRFAN
LRALFAFMWAHPGKQLLFMGGEFGQGSEWSEERGLDWWVLDFDGHKGVQRLVRDLNRVYR
ETPALWSLDASPDGFRWIDADDAMGNVFSFLRRAPDGSAVACVVNFSGAPHEDYRLGLPY
AGAWEEALNTDSYSYAGSGVGNLGAVEAAEEPRHGLPYSARLRVPPLGAVWFRHPGVSAE
AKPVAEAAAVVTAEEILEEAASGEPEERTVAGDTVAGDAAARDAVGATAGKDVEGVGGKA
QEKSA
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcacttggacctggagcgcctggcgggtggggcacaccacgatccgcactcg
atcctcggagcgcacccggggccggggggcgtgaccgtcagggtgctgcggccgctcgcc
gagaaggtccaggtcgtcgtggacggccaggtccatgacatggagcacgtcgcccacggg
gtgttcgcggtgacgatccccggtctggacaaggtgcccgactaccgtttccgggtcacc
tacgccggagccgagccgtacgagatggccgacccctaccggcactggcccacgctgggc
gaggtggacctgcacctgatcggtgaggggcgtcacgagcggctgtgggaggtgctcggc
gcgcgggtcatgcggcacgaggacgtggagggcaccgccttcgccgtgtgggcgccgaac
gcgcgcgggatccgggtgatcggggacttcaatcactgggacggcaccgcctatcccatg
cgctcgctcggcaggtccggtgtctgggagctcttcattcccggcctgggcgagggcgac
cgctacaagttcggcgtcctcggcgcggacggggtctggcgggccaaggccgacccgatg
gcccggcgcaccgagaccccgcccgcgaccgcgtcggtgatcgacaggtccgactacgac
tggcaggacgacgagtggatgcgccggcgcgcgagccacaacgcgctggaagcgccgatg
agcacctacgaggtgcacctcggctcgtggcggccggggctgtcctaccggcagctcgcc
accgagctggtcgactacgtggtggacatggggttcacgcacgtcgagttcatgccggtg
gccgagcacccgttcggcggctcctggggctaccaggtgacgtcctactacgcgccgacc
gcccggttcggcaccccggacgagttccgccatctggtggaccgcctgcacgaggcgggg
atcggggtggtggtcgactgggtgcccgcgcacttcccgatggacgactgggcgctggcc
aggttcgacgggaccccgctgtacgagcacgccgacccggcgcggggcgagcaccccgac
tgggggacctacgtcttcgacttcggccgccgggaggtgcgcaacttcctggtcgccaac
gcggtctactggctgcgcgagttccacatcgacgggctgcgggtggacgcggtcgcctcg
atgctctatctcgactactcgcggcgcgagggcgagtggacgcccaacgagtacggcggg
cgggagaacctcgacgcggtggagttcctcaaggagatgaacatggtctcctaccgggac
cagccggggatcatcaccgtcgccgaggagtcgaccgcctggcccggggtctcccggccg
gtgcacctgggcgggctcgggttcgggttcaagtggaacatgggctggatgcacgacacc
ctcgcctacctcaagcacgagccgatcttccggcagtaccaccaccaccagatgacgttc
tccctgatgtacgcctactcggagaacttcgtgctgccgctgtcgcacgacgaggtggtg
cacggcaaggggtcgctgctcggcaagatgcccggcgacgagtggcagcggttcgccaac
ctgcgcgcgctgttcgcgttcatgtgggcccatccgggcaagcaactgctgttcatgggc
ggggagttcggccagggctcggagtggtccgaggagcgcgggctcgactggtgggtgctc
gacttcgacgggcacaagggggtccaacggctggtccgcgacctcaaccgggtctaccgg
gagactcccgccctctggagcctcgacgcctcccccgacggcttccgctggatcgacgcc
gatgacgcgatgggcaacgtgttctcgttcctgcgccgcgccccggacggctcggccgtg
gcctgcgtggtcaacttctccggcgcgccgcacgaggactaccgtctcggcctgccctat
gccggtgcgtgggaggaggcgctcaacaccgactcctacagctacgcgggcagcggcgtg
ggcaacctcggcgccgtggaggcggcggaggagccccggcacggcctgccgtactccgcc
cgcctgcgcgtcccgccgctgggcgccgtctggttccgccaccccggcgtgagcgccgag
gcgaagcccgtcgcggaggccgcggccgtggtcacggccgaagagatcctggaggaggcg
gcgagcggggagccggaggagaggaccgtggccggtgacacggtggccggcgacgccgcg
gcccgggacgccgtgggcgcaaccgccggaaaggacgtcgaaggggtcggggggaaagcc
caggagaagtcagcctga

DBGET integrated database retrieval system