KEGG   Streptosporangium roseum: Sros_8559Help
Entry
Sros_8559         CDS       T01137                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sro  Streptosporangium roseum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sro00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9443417..9444814
Genome map
AA seq 465 aa AA seqDB search
MPQIPEPRTLRELRASGHIHRTVKAEIRENLLARLRAGEPRFPGIVGFDDTVLPHLERAL
LAGHDLVLLGERGQGKTRLIRTVTGLLDEWTPVVDGCEINDHPYEPSCVRCRRLAGEAGE
ELPISWKHRDERYGEKLATPDTSVGDLIGDIDPIKIAEGRTLGDPETVHYGLVPRSNRGV
FSVNELPDLAERIQVSLLNVLEERDIQVRGYNLRLPLDILLIASANPEDYTNRGRIITPL
KDRFGAEIRTHYPLSIEAELTLIRQEAALDQVGADLPEHLVEVIARFTRLVRESTAVDAR
SGVSARFSIAAAETAAASAVRRAALTGEEHAVTRVADLPGIVHTLRGKVEFEVSEEGRET
EVLAHLLRRAVAETFRGTLGGADLNALLERFSEGVQVESGPMIPAAELLRRIGPVPGLAK
IMSRLGIGDESPGHAAAALEFALEGLYLLRRLSKDEVDGTAVYRT
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgcctcaaatcccagagccacgtactctgcgcgagctacgcgcgagcggccatatccac
cgtacggtaaaggccgagatccgcgagaacctcctggcccgcctcagggccggagagccg
cggttccccggcatcgtgggcttcgacgacaccgtcctgccgcatctggaacgagccctg
ctcgccgggcatgacctggtcctgctgggtgagcgcggccagggcaagacccggctcatc
cgcaccgtcaccggcctgctcgacgagtggacgccggtcgtcgacggctgcgagatcaac
gaccatccctacgagccctcctgcgtccgctgccgccgcctggccggcgaggcgggcgag
gagctgccgatctcctggaagcaccgggacgagcggtacggcgagaagctcgccaccccc
gacacctccgtcggcgacctgatcggcgacatcgacccgatcaagatcgcggaagggcgc
acgctcggcgacccggagaccgtccactacggcctggtcccgcggagcaaccggggtgtc
ttctccgtcaacgagctgcccgacctggccgaacggatccaggtgtcgctgctcaacgtg
ctggaggagcgcgacatccaggtccgcggctacaacctgcggcttccgctggacatcctg
ctgatcgccagcgccaaccccgaggactacaccaaccgcggccggatcatcactccgctg
aaggaccgcttcggcgccgagatccgcacccactacccgctctcgatcgaggccgagctc
acgctcatccgccaggaggcggcactcgaccaggtgggcgccgacctccccgagcacctg
gtcgaggtgatcgcccgcttcacccggctggtccgcgagtccacggcggtcgacgcccgt
tccggggtgtcggcccgcttctccatcgccgcggccgagaccgccgcggcctccgccgta
cggcgtgcggccctgaccggcgaggagcacgcggtcacccgggtggccgacctgccgggc
atcgtgcacacgctgcgcggcaaggtggagttcgaggtcagcgaggagggccgggagacc
gaggtcctcgcccacctgctccgccgggccgtggccgagacgttccggggcacgctcggg
ggcgcggacctgaacgcgctgctggagcggttctccgagggtgtccaggtcgagtccggg
cccatgatccccgccgccgagctgctgcgcaggatcggtccggtgcccggcctggccaag
atcatgtcgaggctcggcatcggcgacgagtcaccgggccacgccgcggccgcgctggag
ttcgccctggaggggctctacctcctgcgccgcctgtccaaggacgaagtggacggcacg
gcggtctaccgcacctga

DBGET integrated database retrieval system