KEGG   Streptosporangium roseum: Sros_8617Help
Entry
Sros_8617         CDS       T01137                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sro  Streptosporangium roseum
Pathway
sro00900  Terpenoid backbone biosynthesis
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sros_8617
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Sros_8617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACZ91259
UniProt: D2B425
Position
complement(9510382..9511284)
Genome map
AA seq 300 aa AA seqDB search
MNSVTVRVPAKVNLQLAVGPLRDDGYHDLVNVFHAVSIFDEVTATAETGMSVRVEGESAD
QVPEDDDNLAIRAALALARHAGRSYGVNLIIRKAIPVAGGMAGGSADAAAALVACNELWG
LGLPVEDLMEIAADLGSDVPFALLGGTAVGTGRGERLTPLEVGGRFHWVFALADGGLSTA
KVYAECDRMREATGEEIAWPRAADPLLAALRRGDAKALGSELANDLQPAAVMLRRSLART
LEAGREQGAVGTLVSGSGPTCAFLAESEAHAGELALSLKAAGVARDVITAYGPVPGPTVV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaactccgtgaccgtccgtgtgcccgcgaaggtcaacctgcagctggcggtcgggccg
ctccgtgacgacggctaccacgacctggtgaacgtcttccacgccgtctcgatcttcgat
gaggtgacggccaccgcggagaccgggatgagcgtccgggtcgagggcgagtccgccgac
caggtgcccgaagacgacgacaacctcgcgatccgggccgccctggcgctggccaggcac
gcggggcgctcctacggcgtgaacctgatcatccgaaaggcgatcccggtggcgggcggc
atggccggcggcagcgccgacgccgcggccgcgctggtcgcctgcaacgagctgtgggga
ctcggcctgccggtcgaggacctgatggagatcgccgccgacctcggcagcgacgtcccg
ttcgcgctgctcggcggtacggccgtcggcaccggcaggggggaacggctcacgcctctg
gaggtgggaggccggttccactgggtgttcgccctggccgacggcggcctgtccacggcc
aaggtctacgccgagtgcgaccgcatgcgcgaggcgaccggcgaggagatcgcctggccc
cgggccgccgacccgctgctggccgcgctccgccggggagacgccaaggccctcggctcc
gagctggccaacgacctgcagcccgccgccgtgatgctccgccgctccctcgcccggacc
ctggaggccggtcgcgagcagggcgccgtgggcaccctcgtctccggctccggccccacc
tgcgccttcctcgccgagtccgaggcccacgcgggcgagctggccctgtccctcaaggcc
gccggcgtggcccgcgacgtcatcaccgcctacggccccgtccccggtccgacggtggta
tag

DBGET integrated database retrieval system