KEGG   Streptosporangium roseum: Sros_8859Help
Entry
Sros_8859         CDS       T01137                                 

Definition
ABC transporter permease
Orthology
K01992  
ABC-2 type transport system permease protein
Organism
sro  Streptosporangium roseum
Module
ABC-2 type transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9782162..9782923
Genome map
AA seq 253 aa AA seqDB search
MSKHFLGDTAILLGRSLRHITRSMDTIVTTAIMPVAMMLMFVYVFGGAIKTGSDSYVNYL
LPGILLITVASGIAYTAFRLFTDMQSGIFERFQSMPTARSSVLWAHVLTSLIANLISLVV
VVLVALLMGFRSGAGVLGWLAVAGILILFTLALTWIAVIPGLTAKTVDGASAFSYPLIFL
PFLSSAFVPTDTMPGPVRAFAEHQPVTSIVNAIRDLFAQQPVGTDIWIALAWCVGLLIVA
YIFAMNTYRRRIA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcatttcctcggtgacaccgccatcctgctgggacggtccctgcgccacatc
acgcgcagcatggacaccatcgtcacgactgcgatcatgccggtcgccatgatgctgatg
ttcgtctacgtgttcggcggcgcgatcaaaacagggtcggattcgtatgtgaactacctg
ctgcccggcatcctgctcatcacggttgcctcgggcatcgcctacaccgcgttccggctc
ttcaccgacatgcagagcggcatcttcgagcgattccagtccatgccgaccgcgcgctcg
tccgtgctgtgggcgcacgtgctgacctcgctgatcgccaatctgatctcgctcgtggtc
gtcgtgctcgtcgccctgctcatgggcttccgctcgggggcgggagtgctggggtggctc
gcggtcgccggcatcctgatcctgttcaccctggcgctgacgtggatcgccgtcatcccc
ggtctcaccgcgaagaccgtcgacggcgcgagcgcgttctcctacccgctcatcttcctg
ccgttcctcagctcggcattcgtgcccaccgacaccatgcccggcccggtgcgcgccttc
gccgagcaccagccggtgacctccatcgtcaacgccatccgcgacctgttcgcccagcag
ccggtcggcaccgacatctggatcgccctcgcctggtgtgtcggcctcctcatcgtcgcc
tacatcttcgccatgaacacctaccgccgcaggatcgcctag

DBGET integrated database retrieval system