KEGG   Streptosporangium roseum: Sros_9114Help
Entry
Sros_9114         CDS       T01137                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
sro  Streptosporangium roseum
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sros_9114
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sros_9114
   00650 Butanoate metabolism
    Sros_9114
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Sros_9114
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sros_9114
   00622 Xylene degradation
    Sros_9114
   00621 Dioxin degradation
    Sros_9114
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sros_9114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10060314..10061291)
Genome map
AA seq 325 aa AA seqDB search
MTHDEPGRDARRVKIAIIGSGNIGTDLMFKALLSKRVEVVAMAGIDPDSDGLARARRRGV
ATTHEGVEGLVGLPGFAGVDVVLDATSAKAHLHNDRVLREHGKRVIDLTPAAVGPYVVPP
VNLDAHLAERNLNMVTCGGQATIPIVAAVASQVPVRYAEIVASIASRSAGPGTRANIDEF
TETTSRAIEEVGGAARGKAIIVLNPAEPPLIMRDTVYCLVGDCDEAAVAGAVRAMVERVR
DYVPGYRLKQDVQFERIPEGEPLPDGGRGGGTKVSVFLEVEGAAHYLPAYAGNLDIMTSA
ALRTAERLVDLPDRTGQTVDTGVRA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgacgagcccggcagggacgcacgacgggtcaagatcgcgatcatcggctcc
gggaacatcggcaccgacctgatgttcaaggcgctgctgtccaagcgggtcgaggtcgtc
gccatggcgggaatcgaccccgattccgacggcctcgcccgcgcccgccggcgtggggtg
gcgaccacccacgagggggtcgagggcctggtcgggctgccggggttcgccggcgtggac
gtcgtcctcgacgcgacctcggcgaaggcgcacctccacaacgaccgggtgctcagggag
cacggcaagcgggtcatcgacctgacccccgccgccgtcgggccctacgtggtgcctccg
gtcaacctggacgcccatctcgccgagcggaacctcaacatggtcacctgcggcgggcag
gcgacgatcccgatcgtggcggcggtggcctcgcaggtccccgtccgctacgccgagatc
gtcgcctcgatcgcctccaggtcggccggccccggcacccgcgccaacatcgacgagttc
accgagacgacctcccgggcgatcgaggaggtcggcggggccgccaggggaaaggcgatc
atcgtcctcaacccggccgagccgccgctgatcatgcgtgacacggtctactgcctggtc
ggcgactgcgacgaggccgccgtggcgggagccgtgcgggccatggtggagagggtccgc
gactacgtgcccggctaccggctcaagcaggacgtgcagttcgagaggatcccggagggg
gagccgctgcccgacggagggcggggcggcgggaccaaggtgagcgtcttcctggaggtg
gagggcgcggcccactacctgcccgcctacgcggggaacctggacatcatgacgtcggcc
gcgctgcgcaccgccgaacggctggtcgacctgccggaccgtaccggacagactgtggac
acgggggtgcgcgcgtga

DBGET integrated database retrieval system