KEGG   Streptosporangium roseum: Sros_9170Help
Entry
Sros_9170         CDS       T01137                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sro  Streptosporangium roseum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sros_9170
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Sros_9170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10116639..10117136)
Genome map
AA seq 165 aa AA seqDB search
MKVVLALGSNLGDRFDTLQGALDSLFDAPGLEFVAVSPVYETDPFGGPEQGPYLNAVVIA
HSTLEPRTLLDRAQGVENAFGRVRAERWGARTLDVDLITVGDVVSDDPELTLPHPRAHER
AFVLVPWSRADPDAVLSGRRVDDLLAALDQDYVRLRADLTLQRPI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgtgctggcgctcggcagcaacctgggcgaccggttcgacacgctgcagggc
gcgctcgactcgctcttcgacgcgccgggcctcgaattcgtcgcggtgtcgccggtctac
gagaccgacccgttcggcggccccgagcaggggccctacctcaacgcggtggtgatcgcg
catagcaccctggaacccaggacgctcctcgatcgtgctcaaggtgtggagaacgccttc
ggccgggtccgggcagagcgctggggagcgcgcaccctggacgtcgacctgatcaccgtg
ggggacgtcgtctccgacgaccccgagctgacgctgccgcacccccgggcacacgagcgc
gcgttcgtgctggtgccgtggtcgcgggccgacccggacgcggtcctgtccggtcgccgg
gtcgacgacctgctggccgcgctggaccaggactacgtacggctccgcgccgacctgacg
ctgcagaggcccatttga

DBGET integrated database retrieval system