KEGG   Streptosporangium roseum: Sros_9174Help
Entry
Sros_9174         CDS       T01137                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sro  Streptosporangium roseum
Pathway
sro00790  Folate biosynthesis
sro01100  Metabolic pathways
Module
sro_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sros_9174
Enzymes [BR:sro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sros_9174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACZ91793
UniProt: D2BB29
Position
complement(10119304..10119885)
Genome map
AA seq 193 aa AA seqDB search
MSVKPLQVDSARIEKAVREILIALGEDPDRDGLQDTPARVARAYAEQFAGLGQSPEDVLT
TVFDVDHDEMVLVRDIEVYSTCEHHLVPFHGVAHVGYIPNEKGQVTGLSKLARLVDVYAR
RPQVQERMTSQIADALMSVLEPRGVIVVIECEHLCMTMRGVRKPGAKTITSAVRGDFRNS
DKTRAEAMALILR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgaagccgttgcaggtcgattcggcccggatcgagaaagccgtccgcgagatc
ctgatcgcgctcggtgaggatccggaccgggacggcctgcaggacaccccggcccgcgtc
gcccgcgcctacgcggagcagttcgccgggctggggcagtccccggaagacgtactgacc
acggtcttcgacgtcgaccacgacgagatggtgctcgtgcgcgacatcgaggtctactcg
acctgcgagcaccacctggtgccgttccacggtgtcgcccacgtcggttacatcccgaac
gagaagggtcaggtcaccggcctgtccaagctcgcccgcctcgtcgacgtctacgcccgc
cgcccccaggtccaggagcggatgacctcccagatcgccgacgcgctcatgagcgtgctg
gagccccgcggggtcatcgtcgtcatcgagtgcgagcacctctgcatgaccatgcgaggt
gtccgcaagcccggtgccaagaccatcacctcggctgtgcgcggtgatttccgcaacagc
gacaagacgcgcgccgaagcgatggcgctcatcctccgctga

DBGET integrated database retrieval system