KEGG   Streptosporangium roseum: Sros_9313Help
Entry
Sros_9313         CDS       T01137                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sro  Streptosporangium roseum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sro00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sros_9313
DNA repair and recombination proteins [BR:sro03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sros_9313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10266091..10266690)
Genome map
AA seq 199 aa AA seqDB search
MYEGVVQNLIDELGMLPGVGPKSAQRIAFHLLAAEPTDVKRLAHALLEVKEKVRFCRVCG
NVAAEEECRICRDVRRDPHVICVVEESKDVVAIEKTREFRGRYHVLGGAISPIDGVGPDD
LRIRELMTRLADGQVTELILATDPNLEGEATATYLARLVKPMGLKVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLLDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaggggtcgtccagaacctgatcgacgagctggggatgctccctggcgtcggt
cccaagagcgcgcagcggatcgcgttccacctgctggccgccgagccgaccgacgtgaag
cggctcgcccacgccctgctcgaggtcaaggagaaggtccgcttctgccgggtctgcggg
aacgtcgcggccgaggaggagtgccggatctgccgtgacgtccggcgcgatccccacgtg
atctgcgtcgtcgaggagtccaaggacgtggtcgcgatcgagaagacccgcgagttccgg
ggccgctaccacgtgctcggcggggcgatcagcccgatcgacggagtcggccccgacgac
ctccggatccgcgaactgatgacacgcctggccgacggccaggtgaccgagctgatcctc
gccaccgaccccaacctggagggggaggcgacggcgacctatctcgcccgtctggtgaag
ccgatgggactgaaagtcacacgactggccagcggcctgcccgtgggcggtgacctcgaa
tatgccgatgaggtcaccttgggccgcgcgttcgaaggaaggaggctgctggatgtctga

DBGET integrated database retrieval system