KEGG   Streptococcus suis ST1: SSUST1_0185Help
Entry
SSUST1_0185       CDS       T02125                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
srp  Streptococcus suis ST1
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:srp00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:srp00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172765..174966
Genome map
AA seq 733 aa AA seqDB search
MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETASYQYVREDEYRALTSF
VEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSHFVYQGHVIYAGRSALKGL
PHLYLDEEGQADSLDIYLLDEESQTRLVLSYTIFRDYPAVTRSARFEQLGEQSVCLNRAL
SMTLCLPDMDYDWLHLDGPWGRERHLQLSPLHQGCQSIYSLKGASSAEHNPFMALKRPTA
DEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGIHPERFSWTLDKGEEFQTPEVVMVY
SEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLLNNWEAMSFDFDEETILSLAKEAAGLG
VELFVMDDGWFGKRNHDRAGLGDWTVNREKLPSGLTGIIDQVHAMGMKFGLWIEPEMVNK
DSDLYRAHPDWIFRHPQHSQSHGRHQYTLDLSREDVYQNIHDQLHRLLAEHDIDYIKWDM
NRYMTEVFTCTREAERQGETFHRYILNLYRLYDSLIAAFPTVLFESCSSGGARFDPGMLY
YAPQTWVSDDTDAMERLKIQYGTSMVYPLNSMGCHVSASPNQQLGRATPLNTRANVAFFG
SFGYELDLFECSQEELEEMKEQIAFYKAHRKLFQQGIFTRLKSPFDGEITAWQVQSSDCQ
QVIVGYYRRLTTANLAYQRLYLQGLEEEAVYHLDGEVYTGSQLMHTGLSIRHGDHVGDNK
DFTSYLMILQKQQ
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgggaattatctttcatgaaaagacaaaggaattccatctttacaatgagtttattagc
tatgtgttgacggtcttgcctaatggtcatattggtagtttgtattatggaaagcgtgta
acagaaacagcttcttatcagtatgtgcgtgaagatgagtatcgtgctttgacttccttt
gtagaagacgatgaccgtttcttttcgctccaatatgccaatcctgaatttgcttgttat
ggtacaacggactatttttctccgacttttgagttggtgcagaaggacggtagtagcctg
tcgcactttgtgtatcaaggtcatgtgatttatgctgggcgatcggctttgaagggtctt
cctcatctctatctggatgaggagggacaggcagatagtttggatatttatttgttggat
gaagagtcgcagacccgcctggtcttgtcttatacgatttttcgagattatccagcggtg
actcgctctgctcgttttgaacaactcggagaacaatctgtctgtttgaaccgtgccttg
agtatgacactttgtctgcctgatatggactatgattggttgcatttggatgggccttgg
gggcgtgagcggcatctgcaactatcgcctcttcatcaaggttgtcagtctatttacagt
ctcaaaggggctagtagtgcggagcacaatccctttatggctttgaaacgcccaactgcg
gatgagcaacagggagaggtactaggcttctcgctcgtctatagcggaaactttttggcg
caggtggatgtgagttctttccaaaaaacaagagtgagtatgggaatccatcctgagcgt
ttttcttggacattagataagggagaagagttccagacgcctgaggttgttatggtttat
agcgagcatggtttgaatggcatgagccaaacctatcaccgcctcttccaaaaacatctg
gtacgtggctattggcgtgatagagagcgacctgttctcttgaataactgggaagccatg
agttttgattttgatgaggaaacaattctttccttggccaaagaggctgcaggtcttggt
gttgaactctttgtcatggatgatggttggtttggcaagcgaaaccatgaccgagcaggc
ttgggagattggacggtcaaccgagagaaattaccaagtggcttgacagggattattgac
caagttcatgctatgggaatgaaatttggactttggattgaacctgaaatggttaataaa
gacagcgatttataccgagcgcatccagactggatttttcgtcatcctcagcatagtcaa
tctcacggacgccaccaatatacgttggatttgtcgagggaggatgtttatcaaaatatt
catgaccaactccatcggctgttggctgagcatgatattgattatatcaagtgggacatg
aatcgctatatgacagaggtctttacatgtacacgggaggcggagcgacaaggtgagacc
ttccatcgctatattctcaatctctaccgtttatatgatagcctaatagcagcttttccg
acagtcttattcgaatcttgttcaagtggtggagctagatttgacccgggaatgctctac
tatgcaccgcaaacctgggtcagcgatgacacggacgccatggaacgcttgaaaatccaa
tacggaacgagcatggtctatcctttgaatagtatgggctgccatgtgtcagctagtcca
aatcagcagttggggcgtgctactccactaaacacacgtgccaatgttgcattctttgga
agttttggctatgaattggatttgtttgagtgtagccaagaagagttggaagagatgaaa
gagcagattgccttttacaaggctcaccgtaagcttttccaacagggtattttcactcgt
ctgaaaagtccattcgatggagaaataacggcttggcaggtccaatcctcggattgtcag
caagtcatcgtgggttattaccgtcggttaacaactgccaatcttgcctatcaacgcttg
tacttgcaggggttggaagaggaagcggtctatcaccttgatggagaagtttatactggt
agccaattaatgcatacaggtttgtcgattcgacatggggaccatgttggagacaataaa
gactttacttcttatttgatgatcctccagaaacaacagtag

DBGET integrated database retrieval system