KEGG   Streptococcus suis ST1: SSUST1_0276Help
Entry
SSUST1_0276       CDS       T02125                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
srp  Streptococcus suis ST1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:srp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSUST1_0276 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST1_0276 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SSUST1_0276 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSUST1_0276 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSUST1_0276 (adhA)
   00626 Naphthalene degradation
    SSUST1_0276 (adhA)
Enzymes [BR:srp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSUST1_0276 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(269313..270089)
Genome map
AA seq 258 aa AA seqDB search
MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVANGDFGKVPGRVLGHE
GIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPGQWIAIYGAGGYVVAVGL
PSEYMDLSIVKTVLDGIKVVGSLVGTRKDLEEAFHFGAMGLVVPVVQKRPVEDAEAVFNE
MVAGTIQGRIVLDFCHSH
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcgttgtaaatccagaatctactggtgttgtcgttgtcgaaaaggaactt
cgtccactcgaagctggtgaggctttggtccaaattgagtactgtggtgtttgtcacact
gacctccacgttgccaatggtgattttggtaaggttcctggtcgcgttcttggtcacgaa
ggaatcggtattgttacagaaatcgcacctggtgttaccagtctaaaagttggtgaccgt
gtcagcgttgcttggttcttccaaggctgtggtatgtgtgaatattgtacaaccggtcgc
gaaactctctgccgtaccgtaaaaaatgcaggctactctgttgacggtggtatggctgag
caatgtattgtaacagcagactatgcagtaaaagttccagaaggtcttgatccagctcaa
gcaagttctatcacttgtgctggcgttacttgctacaaagcgattaaagaagctcacttg
gaaccaggtcaatggatcgctatctatggtgctggtggatatgtagtagctgtcggactc
ccatcagaatacatggacctcagtatcgtgaagactgttttggacggtatcaaggttgtc
ggctccctagttggtactcgtaaagacttagaagaagccttccacttcggtgctatggga
ctagttgttccagtcgttcaaaaacgccctgtcgaagatgccgaagcagtcttcaatgaa
atggttgccggtactatccaaggtcgtattgtcttagacttctgccactcacactaa

DBGET integrated database retrieval system