KEGG   Streptococcus suis ST1: SSUST1_0278Help
Entry
SSUST1_0278       CDS       T02125                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
srp  Streptococcus suis ST1
Pathway
srp00260  Glycine, serine and threonine metabolism
srp00750  Vitamin B6 metabolism
srp01100  Metabolic pathways
srp01110  Biosynthesis of secondary metabolites
srp01120  Microbial metabolism in diverse environments
srp01230  Biosynthesis of amino acids
Module
srp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:srp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSUST1_0278
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSUST1_0278
Enzymes [BR:srp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSUST1_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AER20698
UniProt: G7SNG2
Position
273606..275090
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFSVLKDASYQDVAKLIL
SAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELFRGSTIAFKDMALSILP
YLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILSAYYAKQIGLPVGKLICASNDNNVLTD
FFSTGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGNDAAKTAELMEALNTTGQYDIQ
GADAEILSLFAAAFATEEETAAEIKRVYDESDYIEDPHTAVASAVYKQYVEQTGDQTPTV
IASTASPYKFPVVAAEAVTGQSGLSDFEALAKLHEISGVDLPPAVDGLETAPVRHNTVVA
AADMQTEVERYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtatatcaatcaacacgcgatgctaaaaatactgtatcggctagtcaagcg
attttgcagggcttggcgaccgacggtggtttgtttacaccgctttctattccaacagtt
gacttggatttttctgttttgaaagatgcttcttatcaagacgttgccaagctgattttg
tcggctttcttggatgattttacggcagatgagttggactactgtatcaataacgcctac
gacagtaagtttgacacgtcagttattgccccagtggttaagctaaaaggtcagtacaac
ttggagctcttccgtggctcaaccattgccttcaaggatatggctctgtccatcctccct
tacttgatggcgacggcgactaaaaagcacggtttggaaaacgaaattgtcatcctgacc
gcgacttcaggcgatacaggcaaggcagccatggctggttttgcggacgttcctggcacg
caaatcattgtcttctatccgcgtgacggggtatctaaggtccaagaattgcagatgacc
acgcagacaggggctaatacccacgtggtggctattgacggtaacttcgacgatgcccag
accaatgtcaaacacatgttcaacgatgaggcactccgtgccaagttggcggctaagaaa
ctccagttttcatctgccaactctatgaacatcggccgcttggtgccacagattgtttac
tatgtctatgcctacgctcagctggttaagactggtgagattgcggcgggcgacaaggtc
aacttcaccgttccaacaggaaactttggtaacatcttgtcggcttactacgctaagcag
atcggtctgccagttggcaagctcatctgtgcttccaacgataacaatgtcctaaccgac
ttcttctcgacaggtgtttacgacaagaaccgtaccttccgcgtgaccaccagtccgtcc
atggacatcttggtgtcctctaacttggagcgcttgattttccatctctttggcaatgac
gctgcaaaaacagccgagctgatggaagccttgaacacaactggtcagtatgacattcaa
ggggctgacgcggaaatcctctctctctttgctgccgcctttgcgacagaagaagaaacc
gctgcggaaatcaagcgtgtctatgacgagtcagactacattgaagatccacatacggct
gttgcctcagctgtctataaacagtatgtggagcaaacaggggaccaaactccgacagtg
attgcttctacagcaagtccttacaagttccctgtggttgcggcagaggcggtgacaggc
cagtcaggtttgtctgactttgaagcccttgcaaaattgcatgagatttcaggtgtagac
ttgccaccagctgtggacggcttggaaacggcacccgtccgccacaataccgtcgttgca
gctgccgatatgcagactgaagtagaacgctatttgggtgtttaa

DBGET integrated database retrieval system