KEGG   Streptococcus suis ST1: SSUST1_0455Help
Entry
SSUST1_0455       CDS       T02125                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
srp  Streptococcus suis ST1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:srp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:srp00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451315..452316
Genome map
AA seq 333 aa AA seqDB search
MIEVKTFGEKAKLYCLENKNGMQVTLTDFGARVVGVFLPVKEGGSLRNVSLAAKSDEDYC
KTDLYPGSTIIPVAGRISGAKAEIKGTSYQFTENEPGRTLHGGVDTANEQYWDVALDHEK
NQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQAVSDKDTIFNPTNHIYFNLTG
DFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEEVTGTPFDFRDFAPFAQGFDSQYPQNVL
VKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYTYNFPVEALACYHGVFSLEC
QALPNACNVDGFGSILLEQGEEFLSKTTYRFTW
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagtaaaaacatttggtgaaaaagcaaaactgtattgcttggaaaacaagaat
gggatgcaggtaaccttgacggattttggagctagagtggtgggagtgttcctgcctgtg
aaagaaggtggcagtttacgaaatgtcagtttggctgctaagtcggatgaagattactgc
aagacagatttgtatcctggttcaacaattatcccagtagcggggcgtatttcaggagcc
aaggctgagataaagggaaccagttatcagttcacagaaaatgagccaggtcgtaccttg
catggtggagttgacacggcaaatgaacaatactgggatgttgctcttgaccatgagaaa
aatcaagtgacctttggtatggtcctaaaagatggttttaatggctttcctggtgatgtg
agggtcaaggctatttattgtttgacggataaaaatgaattgacagttgactaccaggct
gtatcggataaggatacgatttttaatccgaccaaccatatctatttcaacttgactggt
gattttcaacggtcagttgccgagcaccgtattaaaattgctgccaatcactatgctccg
cttggggaggataacctgcccacgggtgtcttagaagaagtgacagggacgccgtttgat
tttagagattttgcgccttttgctcagggatttgatagccaatatcctcaaaatgtgttg
gtaaaaggctatgaccacccatggttattggaagaggtggatattccggtagaagttttg
agtccagatgggaaaattggactcagtgtcaaaaccaaccagcctgcggtcgttatttat
acatataattttcctgttgaagctttggcctgttaccatggtgtctttagtttagagtgt
caggccttgccaaatgcatgcaatgtcgatggatttggttcgattttgttagaacaagga
gaagaatttttgtctaaaacgacctatcgttttacttggtaa

DBGET integrated database retrieval system