KEGG   Streptococcus suis ST1: SSUST1_0565Help
Entry
SSUST1_0565       CDS       T02125                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
srp  Streptococcus suis ST1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:srp03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
567502..568329
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRGLNRLVKGKVISKVEVTYAPMIKTGATVFCQDLIGQEILDVDRRGKYL
LIYLTDHVLISHLRMEGKYNFFPDQVPANKHFHAFFTFSDGSTLVYQDVRKFGTMELLGK
ADVDAYFISRKIGPEPTEEDFDLEEFAKQLAKSRKPIKSHLLDQSLVAGLGNIYVDEVLF
RAQVHPAQASNQLSAEQAADLRQATIEVLQLGIEKGGSTIRTYKNALGMDGTMQDYLQVY
GKTGQACPRCQTEIVKIQLGGRGTHFCPTCQVKYG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattgcctgaggttgagacggttcgtcgtggtttaaatcggttggtcaaggga
aaggttatttccaaggtggaggtgacctatgcccctatgattaagactggtgctactgtt
ttctgccaagacttgattggtcaggagattttagatgtggaccgtcgtggcaagtatctc
ttgatttacctgacagaccatgtccttatttctcacttgcggatggaaggtaagtacaat
ttctttcctgaccaggtgcctgccaacaaacatttccatgccttttttactttttcagat
ggctcgaccttggtttatcaggatgtccgcaagtttggcacaatggaactgctgggcaag
gcagatgtggatgcctattttatcagtcgaaaaattggtcctgagccgacggaggaagat
tttgacttagaagaatttgccaaacagttagctaagtcgagaaagcccattaagtcgcat
cttttggaccagtctttggtggctggtttgggcaatatctatgtagatgaggttctgttt
agagcacaagttcatcctgctcaagcaagtaatcagctatcggcagagcaggcggcagac
ctccgtcaagctaccatagaagttctgcaactgggtattgaaaaaggtggttcaaccatt
cggacttacaaaaatgccttgggcatggatgggactatgcaggattatttacaagtttat
ggaaagacaggacaggcttgtccccgttgccagacagagattgtcaaaatccagctgggt
ggtcgagggacacatttctgtcccacgtgtcaggtgaaatatggctaa

DBGET integrated database retrieval system