KEGG   Streptococcus suis ST1: SSUST1_1005Help
Entry
SSUST1_1005       CDS       T02125                                 

Gene name
glkA
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
srp  Streptococcus suis ST1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUST1_1005 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST1_1005 (glkA)
   00052 Galactose metabolism
    SSUST1_1005 (glkA)
   00500 Starch and sucrose metabolism
    SSUST1_1005 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SSUST1_1005 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSUST1_1005 (glkA)
   00524 Butirosin and neomycin biosynthesis
    SSUST1_1005 (glkA)
Enzymes [BR:srp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSUST1_1005 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(998735..999694)
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSVKLAILTTEGEIQEKLSIKTNILDDGSHIVPDIIDSIKQRFETHGL
TKDDFLGIGMGSPGVVDSEAGTVIGAYNLNWKTLQLVKEQFESALGLPFFIDNDANVAAL
GEQWVGAGNNNPNVVFMTLGTGVGGGVIAAGNLIRGVKGAGGELGHITVDFDEPFACTCG
KKGCLETVASATGIVNLSRRYADQYAGDAKLKQMIDDGQDVTAKDVFDLAKEGDDLALIV
YRHFSEYLGVACANIAAVLNPAYIVLGGGVSAAGEFLLDGVRKVFAENSFPQIKESTQIV
LATRGNDAGVLGAASLVLK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaattatcggtattgaccttgggggaacttctgttaaattggccattttg
actactgagggagaaattcaagaaaaattgtctatcaagacaaatattttagatgatgga
agtcatattgttcctgatattattgacagtatcaagcagcgatttgaaacccatggtttg
acaaaggacgatttcttaggaattggtatgggctcacccggtgtagtggatagtgaagct
ggcactgttatcggagcctataacctcaactggaagaccttgcaattggtcaaagagcag
tttgaatctgcgctcggtttaccattctttattgacaatgatgcaaacgtagcggccctc
ggtgaacaatgggttggtgctggaaacaacaatccaaacgttgtctttatgacgcttggt
acaggtgtcggtggcggtgtcatcgctgctggaaacttgattcgtggtgtcaaaggtgct
ggtggcgaattgggccatatcacagttgactttgatgagccatttgcatgtacttgtggt
aagaaaggttgtctagaaacagttgcttcagcgacaggtattgtcaacctcagccgtcgc
tatgctgatcaatacgcaggcgatgcaaaactgaaacaaatgattgatgatgggcaagat
gtaacggctaaagatgtctttgatttggcaaaagagggcgatgatttggctttgattgtc
taccgtcacttctcagaatacttaggtgttgcttgtgcaaacattgctgcagtcctcaat
cctgcctacatcgttcttggtggtggtgtatcagctgcgggagagttcttattggatggc
gttcgcaaggtctttgctgaaaatagcttcccacaaatcaaggaaagtacacaaattgtc
ttggcaacacgtggtaatgatgcaggtgtattgggcgcagcatcactcgtcttgaaataa

DBGET integrated database retrieval system