KEGG   Streptococcus suis ST1: SSUST1_1046Help
Entry
SSUST1_1046       CDS       T02125                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
srp  Streptococcus suis ST1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:srp00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:srp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1042911..1043834)
Genome map
AA seq 307 aa AA seqDB search
MTITNGKVSLKHLVTMETLSNEEVLGLIQRGIAFKRGEKVELDRKYYASNLFFEDSTRTH
KSFEMAELRLDMGMIDFDARTSSVNKGETLYDTILTMSALGVDICMIRHSEVDYYKQLID
SPTIQTSIVNGGDGSGQHPSQSLLDLMTIYEEFGTFEGLKIAIAGDITHSRVAKSNMQIL
KRLGAEIFFAGPEEWYAEEFDVYGQHLNIDDIVETVDVLMLLRVQHERHDGDGGFSKETY
NRLHGLTEERYKRLKDTAIVMHPAPVNRDVEIDDSLVEAPKSRIVRQMQNGVFVRMAILE
AIVNGKA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaattacaaatggtaaagtttcactcaaacacttggttacaatggagaccctctca
aatgaagaagtattgggactcattcaacgtggtattgcttttaaacgcggtgaaaaggta
gagttggatcggaagtactatgcttctaaccttttctttgaggattcaactcggacgcat
aagtcttttgaaatggcagagcttcgtttggatatgggaatgattgactttgatgctcgt
accagctcagtcaataagggtgaaaccttgtatgatactattttgaccatgtcggcactc
ggggtagacatctgcatgattcgtcactcggaagtggattattacaagcaattgattgat
agtcctaccattcagacttcaattgtcaatggtggtgatggttcaggtcaacacccaagc
caatccctacttgatttgatgactatttatgaagaatttggaacttttgaaggcttgaag
attgccattgcaggcgatattacacactcacgggttgctaagtcaaatatgcaaattttg
aagcgtctgggagctgagattttctttgctggaccggaggaatggtacgcagaggaattt
gatgtctatggtcagcatttgaatattgatgatattgtggaaacggtagatgtactgatg
ttgctccgtgtacaacacgaacgacatgatggtgatggtggtttttctaaagaaacttat
aaccgtttgcatggtttaacagaggagcgctacaaacgcttgaaagatactgcaattgtt
atgcatcctgcccctgttaaccgcgatgttgagattgatgattctctagttgaagcaccc
aaatcacgcattgtccgtcaaatgcagaatggtgtatttgtccggatggcgattttggaa
gcaattgtcaatggcaaggcttaa

DBGET integrated database retrieval system