KEGG   Streptococcus suis ST1: SSUST1_1272Help
Entry
SSUST1_1272       CDS       T02125                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
srp  Streptococcus suis ST1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:srp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUST1_1272 (pfk)
   01230 Biosynthesis of amino acids
    SSUST1_1272 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST1_1272 (pfk)
   00030 Pentose phosphate pathway
    SSUST1_1272 (pfk)
   00051 Fructose and mannose metabolism
    SSUST1_1272 (pfk)
   00052 Galactose metabolism
    SSUST1_1272 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SSUST1_1272 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SSUST1_1272 (pfk)
Enzymes [BR:srp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSUST1_1272 (pfk)
Protein phosphatases and associated proteins [BR:srp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSUST1_1272 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1262857..1263867)
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDI
ISRGGTFLGSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRHAGDIALWA
GIASGADVIVVPEEDFNINDVVDRIKAGYDKGKKHSIIVLAEGVMPVAQFAEELKAAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGRGGLAVGIRNEQMVENPILGT
AEEGALFSLTTDGKIVVNNPHKADLELADLNRNLSI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggtgatgcccctggtatgaacgctgctatt
cgtgcagttgttcgccaagcaatttcagaaggaatggaagtttatggaatcaacgaaggt
tacgcaggtatggttgcgggtgatatccatgaattgtctgcacgttctgtaggtgatatt
atttcacgtggaggaacattccttggttcagctcgttatccagaatttgccaaattagaa
gggcaacttaaagggattgagcaattaaaaaaacatggtatcgaaggtgtagttgttatc
ggtggtgacggttcttaccacggagcaatgcgcttgacggagcatggtttcccagctatt
ggtgtacctggtaccattgacaacgacatcgtggggacagattttacaatcggttttgac
acagctgtaacaactgccatggatgcgattgataagattcgcgatacttcatcaagtcac
cgtcgtactttcgtcattgaagtaatgggacgtcatgcaggtgatatcgctctttgggct
ggtattgcttctggtgcagatgttatcgttgttccagaagaagacttcaatatcaacgat
gttgttgatcgcattaaagcgggctacgataaaggtaagaaacatagcatcattgtcttg
gccgaaggtgttatgccagtggcacagtttgctgaagaattgaaagcagcaggcgataca
agtgatcttcgtgtgacagaacttggtcatatccaacgtggtggttctccaacagcgcgt
gatcgtgtactcgcttctcgtatgggtgctcatgccgttaaattgcttaaagaaggccgt
ggaggtcttgcggtaggtatccgtaacgagcaaatggttgaaaatccaattcttggaact
gcagaagaaggtgccttgtttagcttgactactgatggcaagattgtagttaataatccg
cataaagcagatttggagttggctgatttgaaccgtaacttgtcaatctag

DBGET integrated database retrieval system