KEGG   Streptococcus suis ST1: SSUST1_1373Help
Entry
SSUST1_1373       CDS       T02125                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
srp  Streptococcus suis ST1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:srp00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:srp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1353109..1354452
Genome map
AA seq 447 aa AA seqDB search
MKINTALGILAGKSSQFILKKLGRGTTLPGKIALKFDKHILDSLAKDYEVVVVTGTNGKT
LTTALTVGILQEAFGEITTNTSGANMITGITATFLSAKKNKKGKKIAVLEIDEASLARVT
DFIKPSLIVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPQATILANGDTPLFNSTNVINP
VKYYGFATEEHEPRLAHYNTEGVLCPHCHQIIQYKLNTYANLGSYICNNCGFSRPELDYK
LTDLKEITNTSSSFAIDGQDYKINIGGLYNIYNALAAVSVAEFFGVSPEKIKAGFDKSKA
VFGRQETFKLGDKDCTLVLIKNPVGATQAIEMMKLAPYDFSLSVLLNANYADGIDTSWIW
DADFEQITQMDIPQVFAGGVRSSEIARRLRVTGYPENPITETPKLEDIMTLIEQSSSQHA
YILATYTAMLEFRDLLAQRQAVGKEMK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatacagctttgggtattctagcaggaaaaagttcccagttcattttgaaa
aaactaggacgtggtactaccctgcctggaaaaattgccctcaaattcgataaacatatt
ttagatagtttggctaaggattatgaagtcgttgttgtgacaggtactaacggtaagact
ctgaccactgccctgacagttggtatcctccaagaagcctttggcgaaatcacgaccaat
accagcggtgccaatatgattacagggattacggcaacatttttatctgctaagaaaaat
aaaaagggcaagaagattgccgtcttggaaatcgacgaagccagcctggcccgtgtgacc
gactttatcaagcctagcctgattgtctttaccaatatcttccgtgaccagatggaccgc
tacggtgagatttataccacctaccagatgattttggacggggctgcaaaagctccgcag
gcaactattttggccaatggtgatactccactttttaactcgacaaacgttatcaatcca
gtaaaatactacggttttgcgacggaagagcatgagccacgtctggcccattacaatacc
gaaggcgttctctgtcctcattgccaccagattatccagtacaagctcaatacctacgct
aacttgggcagctacatctgtaacaactgtggctttagccgacctgaattggactataag
ttgacagacttgaaagaaatcaccaatacttcttcttcctttgccattgacggtcaggat
tataagatcaacattggcgggctttacaacatctacaatgccctagcagctgtcagcgtg
gcagaatttttcggcgtatctcctgaaaaaatcaaggcaggatttgacaaatcaaaggca
gtctttggtcgccaagaaacctttaaactcggtgataaggattgtaccttggtcttgatt
aaaaaccctgtcggtgcaacccaggctattgaaatgatgaaactggctccatacgatttt
agcctgtccgtccttctcaatgccaactacgctgacggaattgataccagctggatttgg
gacgctgactttgaacaaatcactcaaatggacattccacaagtctttgcaggcggtgtt
cgttcgtctgaaattgcccgtcgcctccgtgtgactggctatcctgagaacccgattact
gaaacgccaaaactagaagacatcatgaccttgattgagcaatcgagtagccaacatgcc
tatattttagctacttatacagctatgctggaattccgcgacctgctggctcaacgccaa
gcagttggaaaggagatgaaataa

DBGET integrated database retrieval system