KEGG   Streptococcus suis ST1: SSUST1_1724Help
Entry
SSUST1_1724       CDS       T02125                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
srp  Streptococcus suis ST1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:srp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUST1_1724
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST1_1724
   00020 Citrate cycle (TCA cycle)
    SSUST1_1724
   00620 Pyruvate metabolism
    SSUST1_1724
Enzymes [BR:srp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSUST1_1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1668408..1669796)
Genome map
AA seq 462 aa AA seqDB search
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQ
GGGKVRATPAARKLARELGIDLGLVPGTGAKGRVHKVDVEDFKGAAPKATPLAARIAADQ
GVDLSTLTGSGVNGKIVKNDVLAVLAPAAVETAAPVPKAEEKPAKELPEGVEIIKMSPMR
KAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRT
LMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGE
IKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcattatgcctaagctcggtgtggacatgcaagaaggtgaaatcatc
gagtggaaaaaacaagagggcgattttgtcaacgaaggcgacgtcatcttggaaatgatg
tctgacaagaccagcatggagctggaagcagaagagtcaggtgtcctattgaaaattgtt
cacggaaacggtgctaccgttcctgtaacagaagttattgcctacatcggtgcagaaggt
gaaacggttgaagccggggcttcatctgctcctgctgttgagccagctgcagcgattgaa
gaagtgccagcaggtcgtacaccagtaatcgttgctcctgcaactgctgccaaaccacaa
ggtggtggcaaggttcgtgcgactccagctgcgcgtaaattggcgcgtgagcttggaatt
gacttgggtcttgttccaggaacaggtgctaaaggtcgtgtccacaaggttgatgtcgaa
gacttcaagggagcagctccaaaagcaactccgcttgcagcccgtattgcagcggaccaa
ggtgttgacttgtcaacccttacaggttcaggtgtcaacggtaagattgtcaagaatgac
gttcttgcagtacttgctccggctgctgtagaaactgctgctccagtaccaaaagcagaa
gaaaaaccagctaaagaattgccagaaggcgttgaaatcatcaagatgagcccaatgcgt
aaggcgatttcaaaaggtatggtcaactcttacttgactgctccgacatttacacttaac
tacgatattgacatgactaacctcatggcacttcgtaagcaagtccttgagccaatcatg
aacaagactggtttgaaagtaacctttacagacttgatcggtcttgcagttgttcgtact
ttgatgaaagaagaacaccgttacatgaacgcatctttgattaacgatgctcaagaaatc
gaattacacaagttcgtcaaccttggtatcgcagtgggtctagatgatggcttggtggtt
ccagttgttcacggcgcagataagatgagcttgtctgactttgtggtggcttcgaaagat
gtcatcaagaaggctcaatctggtaagttgaagggggctgaaatgtcaggttcgaccttc
tctatcaccaacttgggtatgtttggtactaaaacctttaacccaatcatcaaccaacca
aactcagcaatccttggtgtagcatcaacagttcaaacaccagttgttatcgacggcgaa
atcaagatccgtccaatcatggcactctgcttgaccatcgaccaccgtatcattgatggt
atgaacggtgctaagttcatggttgacttgaagaacttgctggaaaacccattggaattg
ttgatttaa

DBGET integrated database retrieval system