KEGG   Streptococcus suis ST1: SSUST1_1940Help
Entry
SSUST1_1940       CDS       T02125                                 

Definition
glucose-1-phosphate-uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
srp  Streptococcus suis ST1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSUST1_1940
   00052 Galactose metabolism
    SSUST1_1940
   00500 Starch and sucrose metabolism
    SSUST1_1940
   00520 Amino sugar and nucleotide sugar metabolism
    SSUST1_1940
Enzymes [BR:srp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSUST1_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1888176..1889075
Genome map
AA seq 299 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILENQKPGAGNEIQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALQHPQVKDDLKQYLIDLGKKLDTKKN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagccgttatcccagctgcaggtttgggaacacgtttcttgcct
gctactaaggctcttgccaaagaaatgttgccaatcgttgacaaaccaaccatccaattt
atcgttgaagaagctcttcgctctggtatcgaagatattttggtggtcactggtaaatca
aagcgttctatcgaagaccactttgattcaaactttgaattagaatataacctcaaagaa
aaaggcaaaaatgatttgttgaaacttgttgatgagacaacgggcattcgactacacttc
attcgtcaaagccacccacgtggacttggcgatgccgttcttcaagctaaagcatttgtc
gggaacgagccatttgttgtcatgctgggcgatgacctcatggatatcacagatacaaaa
gctgtcccattgaccaagcaactcatgaacgactatgaaaaaacacatgcttcaaccatt
gctgtaatgccagttcctcatgaagaagtttctgcatacggtgttatcgctccacaaggt
gaaggtgtcaacggtctctatagtgtggaaacctttgtggaaaaaccaaaaccagaagac
gctccttctgaccttgctattatcggacgctacttactcactcctgaaatctttgagatt
ttagaaaaccaaaaaccaggtgccgggaacgagattcaattgacagatgccattgatact
ctgaacaaaacgcaacgtgttttcgctcgtgaattcaaaggcaaccgttacgatgttggg
gataagttcggtttcatgaaaacttctatcgactacgccctccaacaccctcaagtaaaa
gatgatttgaaacaatacttgattgatcttggtaaaaaattagatacaaagaaaaactag

DBGET integrated database retrieval system