KEGG   Streptococcus suis ST1: SSUST1_1940Help
Entry
SSUST1_1940       CDS       T02125                                 

Definition
(GenBank) glucose-1-phosphate-uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
srp  Streptococcus suis ST1
Pathway
srp00040  Pentose and glucuronate interconversions
srp00052  Galactose metabolism
srp00500  Starch and sucrose metabolism
srp00520  Amino sugar and nucleotide sugar metabolism
srp01100  Metabolic pathways
srp01130  Biosynthesis of antibiotics
Module
srp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSUST1_1940
   00052 Galactose metabolism
    SSUST1_1940
   00500 Starch and sucrose metabolism
    SSUST1_1940
   00520 Amino sugar and nucleotide sugar metabolism
    SSUST1_1940
Enzymes [BR:srp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSUST1_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AER22282
UniProt: G7SPL9
Position
1888176..1889075
Genome map
AA seq 299 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILENQKPGAGNEIQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALQHPQVKDDLKQYLIDLGKKLDTKKN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagccgttatcccagctgcaggtttgggaacacgtttcttgcct
gctactaaggctcttgccaaagaaatgttgccaatcgttgacaaaccaaccatccaattt
atcgttgaagaagctcttcgctctggtatcgaagatattttggtggtcactggtaaatca
aagcgttctatcgaagaccactttgattcaaactttgaattagaatataacctcaaagaa
aaaggcaaaaatgatttgttgaaacttgttgatgagacaacgggcattcgactacacttc
attcgtcaaagccacccacgtggacttggcgatgccgttcttcaagctaaagcatttgtc
gggaacgagccatttgttgtcatgctgggcgatgacctcatggatatcacagatacaaaa
gctgtcccattgaccaagcaactcatgaacgactatgaaaaaacacatgcttcaaccatt
gctgtaatgccagttcctcatgaagaagtttctgcatacggtgttatcgctccacaaggt
gaaggtgtcaacggtctctatagtgtggaaacctttgtggaaaaaccaaaaccagaagac
gctccttctgaccttgctattatcggacgctacttactcactcctgaaatctttgagatt
ttagaaaaccaaaaaccaggtgccgggaacgagattcaattgacagatgccattgatact
ctgaacaaaacgcaacgtgttttcgctcgtgaattcaaaggcaaccgttacgatgttggg
gataagttcggtttcatgaaaacttctatcgactacgccctccaacaccctcaagtaaaa
gatgatttgaaacaatacttgattgatcttggtaaaaaattagatacaaagaaaaactag

DBGET integrated database retrieval system