KEGG   Serratia plymuthica AS9: SerAS9_0153Help
Entry
SerAS9_0153       CDS       T01503                                 

Definition
phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
srr  Serratia plymuthica AS9
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:srr00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:srr00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:srr00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:srr00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:srr00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
178758..179636
Genome map
AA seq 292 aa AA seqDB search
MRILSGIVLAMLAVPLLVQAEEAKEQQIHDKPAVRGSIIANMLQDHDNPFTLYPYDTNYV
LYTDTSNINKEAIKTYNWAEKARKDEVKYQLSLAFPLWRGILGDNSVLGASYTQRSWWQL
SNHGESSPFRETNYEPQVFLGWATDYRFAGWTLRDVEVGLNHQSNGRSDPTSRSWNRGYA
RFMAQNGNWQVDLKPWFRFSESDSSDDNPDITKYMGYYRLKVGYAWGDSVFSVDSHYNWN
SGYGGAELGWSYPISKHVRFYTQVFSGYGESLIDYNFRQTRVGVGVMLNDIM
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattttgtcagggatcgttttggccatgttggcagtgccactgctggtgcaggcg
gaagaggccaaagagcagcaaattcatgataaacccgcagtgcgcggcagcattatcgcc
aacatgctgcaggatcacgacaacccgtttacgctatatccgtacgacaccaactatgtg
ctgtataccgataccagcaatatcaacaaagaggccatcaagacctacaactgggccgag
aaggcgcgcaaggatgaagtgaaataccagctcagcctggccttcccgctgtggcgcggc
attctgggcgacaactcggtgctcggcgcctcttatactcagcgttcctggtggcagctt
tccaatcacggtgagtcgtcgccgtttcgcgaaaccaactacgagccgcaagtattcctc
ggctgggcgacagattaccgctttgccggctggacgctgcgcgacgttgaagtgggcctc
aaccaccagtccaacgggcgttcggatccaacctcccgcagctggaaccgcggctacgcg
cgttttatggcgcagaacggtaactggcaggtggatctgaaaccctggttccgcttctcg
gaaagcgacagcagcgatgacaacccggatatcaccaaatacatggggtattaccgtctg
aaagtcggttacgcctggggcgacagcgtgttcagcgtcgacagccattacaactggaac
agcggctacggcggtgcggaactgggctggagctacccgatctccaaacacgtgcgtttc
tacactcaggtgttcagcggctacggcgaatcgctgattgattacaacttccggcagaca
cgggttggcgttggtgtcatgcttaacgatattatgtaa

DBGET integrated database retrieval system