KEGG   Serratia plymuthica AS9: SerAS9_0157Help
Entry
SerAS9_0157       CDS       T01503                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
srr  Serratia plymuthica AS9
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SerAS9_0157
Enzymes [BR:srr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SerAS9_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
182964..184001
Genome map
AA seq 345 aa AA seqDB search
MTSFTQGTDDWLMRETQFAAFATGPLLDFWRLREEGEFSGVGGVPIRFVRFSSARHQRVV
VISPGRIESYVKYPEVAYDLFHCGFDVMIIDHRGQGRSGRLLADTHRGHVVNFADYIDDF
AQFYRQQVAPRGYRQHFALSHSMGGAILAQFLARQPQAFDAAAFCAPMFGIHLPMPGWMA
DRILNWVEKHPAVRNYYAIGTGQWRPLPYVVNVLTHSRERYRRCLRYYADYPELQVGGPT
YHWVRESIQAGRQIVAQAAKITTPLLLLQAGEERVVDNRSQQAFCQALSDAGHPCEGGKP
RVIQGARHEILFERDAMRAEALNAILRFFAQHLGGAPAADHSIRG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgttcactcaaggcaccgatgactggttaatgcgtgaaacgcagttcgctgct
ttcgctaccggcccgctgctggacttttggcggttgcgggaggagggcgagttcagtggc
gtgggcggcgtgccgatccgcttcgtgcgtttcagctctgcacgtcaccagcgggtggtg
gtgatcagccccggccgtatcgaaagttacgttaaatatccagaagttgcctacgatctg
ttccattgcggttttgatgtgatgattatcgatcatcgcgggcaaggccgttctggccgc
ttgctggctgatacgcaccgcggtcatgtggtaaactttgccgattatattgacgatttc
gcccagttttatcggcagcaagtggcgccgcgcggctaccggcagcactttgcgctgtcg
cattcgatgggcggcgcgatactggcgcagtttctggcgcgtcagccgcaggcgtttgat
gccgctgcgttttgcgcgccgatgttcggcattcatctgccgatgccgggctggatggcg
gaccgcatccttaactgggtggagaaacacccggcggtgcgcaattactatgcgataggc
accggccagtggaggccgctgccctatgtggtcaacgtattgacccacagccgtgaacgc
tatcgccgctgtttgcgttattacgccgattatcccgagttgcaggtgggtggccctacc
taccactgggtaagagaaagcattcaggccgggcggcagattgtcgcgcaggcggctaaa
atcaccacaccgctgttattattgcaggccggtgaggaacgggtggtcgacaaccgttct
cagcaggctttttgtcaggcactgtcagacgcggggcacccttgcgaaggggggaaaccg
cgggttatccaaggcgcacgccatgagatcctgttcgagcgggacgcgatgcgcgccgaa
gcattgaacgcaatcctgcgtttctttgctcaacacttaggtggcgcccctgccgccgac
cactccatcagaggttag

DBGET integrated database retrieval system