KEGG   Serratia plymuthica AS9: SerAS9_0211Help
Entry
SerAS9_0211       CDS       T01503                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
srr  Serratia plymuthica AS9
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:srr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
238387..239409
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGVFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVMEGSNRQEAVASMPGVS
RMSIDLLIKEAEAIAKLGVPVISLFPVIEPSLKSLHAEEAYNPDGLVQRTVRALKDAVPE
LGILTDVALDPYTTHGQDGVIDEHGYVINDISKDILVRQALSHAEAGAEIVAPSDMMDGR
IGAIRDRLEHQGLVNTQIMAYSAKYASCYYGPFRDALGSSSNLKGGNKKTYQMDPANSDE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEQPAVMESLMCFKRAGADGVLTYFAKRVAQWMHDEAMQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccgggcgtctttccaggccgccgtatgcgccgtgtgcgccgtcat
gatttcagccgtcgtctggtggcggagaatcaactgacggttaacgacctgatttatccg
gtatttgtcatggaaggcagtaaccgtcaggaagcggtagcatccatgccaggcgtatcg
cgcatgagtatcgatctgctgattaaggaagcggaagccatcgccaaacttggcgtgccg
gtgatctccctgttcccggtgattgaaccgagtctgaagtcattgcatgcggaagaagct
tataatccggacggtttggtgcaacgtacggtgcgtgcgttgaaagacgcggtgccagag
ttgggtattctgactgacgtggcactggatccttacaccactcacggccaggatggcgtg
attgatgagcacggctacgtcattaacgatatcagcaaagatatactggtgcgtcaggca
ttatcccatgcggaagccggagcggaaatcgtggcgccgagcgatatgatggacggccgt
atcggcgctatccgcgatcgtctggagcatcaggggctggttaatacccagatcatggcg
tactccgccaaatatgcctcctgctactatggcccgttccgcgatgcgctcggttccagc
agcaatctgaaaggcggcaataagaaaacctatcagatggaccctgccaacagtgacgaa
gcgctgcaggaaattgcgcaagatctccaggaaggcgcggatatggtgatggtgaaaccc
ggtatgccttatctggatgtggtgcgtcgggtgaaagacacctttggcgtgccgaccttt
gcctatcaggtttcaggtgaatatgcgatgcacatggcggcgattcagaacggttggttg
caggagcaaccggcggtgatggagtcgctgatgtgctttaagcgcgccggggctgatggc
gtgctgacctacttcgccaagcgggtagctcagtggatgcatgatgaagcgatgcagcgc
taa

DBGET integrated database retrieval system