KEGG   Serratia plymuthica AS9: SerAS9_0259Help
Entry
SerAS9_0259       CDS       T01503                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
srr  Serratia plymuthica AS9
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:srr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:srr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:srr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:srr00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:srr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(303392..305350)
Genome map
AA seq 652 aa AA seqDB search
MSQVHKHAIPSAIAEHALINPEQYQQYYQQSVQDPEAFWGEQGKILDWIKPYSRVKNTSF
DPGHISIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPTQSKQVTYKQLHHDVCQF
ANVLKKLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
KLVITADEGLRAGRAVPLKKNVDDALKNPGVKSITNVVVFQRTGKPGYWQEGRDLWWHEL
TNGVSADCPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTFKYVFDYHDGDV
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVNRLSQVIDKHQVNILYTAPTA
IRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNGKCPIVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNIGTPQEGACEGNLVITDSWPGQARTLFGD
HDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYITLNHGEEPSPELYTEVRNWVRKEIGPIATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPAVVDKLLEEKQSMKVPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtgcataaacacgctattccttctgcaattgcagaacacgccctgattaac
ccagaacaataccaacaatattatcaacagtctgtccaagacccagaggctttctggggc
gagcaaggaaagatcctggactggatcaaaccttatagccgggtaaaaaacacgtcgttc
gacccgggccatatcagtatccgctggtttgaagacggcactctgaacctggcggccaac
tgtctcgatcgccatctggccgaacgcggtgaccagaccgccattatctgggaaggtgac
gaccccacccagtcgaaacaggtgacctacaaacagctgcatcacgatgtctgccagttc
gccaacgtactgaaaaagttgggcgtcaaaaaaggcgacgtcgtggctatctatatgccc
atggtgccggaagccgcggtcgccatgctggcctgtgcacgtatcggtgcggtgcactcg
gtaatctttggcggtttctcgccagaggcggtcgccggccgcattatcgactccaattcc
aagctggttatcaccgctgacgaaggcctgcgcgccgggcgcgccgtaccgctgaaaaag
aacgtcgacgacgcgctgaaaaatcctggcgtgaaaagcatcaccaacgtggtcgttttc
caacgcaccggcaagccgggttattggcaggaaggccgtgatttatggtggcatgaactg
accaacggcgtttccgccgactgtccaccggaagagatgaatgcggaagacccgttgttt
atcctttatacctccggatcgaccggcaaacccaagggcgtgctgcacaccaccggtggc
tatctggtgtatgccgccatgaccttcaagtacgtcttcgactaccacgacggtgacgtg
tactggtgtacggccgacgtcggctgggttacaggccacagctatctgctctacggcccg
ctggcctgcggcgccatcaccctgatgttcgaaggcgtgccgaactatcctggcgtcaac
cgcctgtcacaggtgattgataagcatcaggtcaatatcttgtataccgcccccaccgcc
attcgtgcgctgatggccgaaggcgataaagcgatagaaggcaccaaacgcgattcactg
cgcatcatgggttcggtcggggagccgatcaacccggaagcctgggagtggtattacaac
aaaatcggtaacggcaaatgcccgatcgtcgacacttggtggcagaccgaaaccggcggc
tttatgatcaccccgctgccgggtgcaaccgagttgaaagccggctctgccacgcgcccg
ttcttcggcgtgcagcctgccttggtcgataacatcggcacaccgcaggaaggtgcctgc
gaaggcaatttggtgatcaccgattcctggccaggccaggcacgtacgctgtttggcgat
cacgatcgctttgagcagacttacttctcaacctttaaggggatgtatttcagcggtgac
ggcgcacgccgtgatgaagatggatattactggatcacagggcgcgtcgatgacgtgctg
aacgtttccgggcaccgtctgggtaccgcagaaatcgagtctgcgctggtctcgcatccg
aaaatcgccgaagcggcggtagtcggtattccgcataacattaaaggtcaggcaatttat
gcctatatcacgctgaatcatggcgaagaaccttctcccgaactctataccgaagttcgt
aactgggtacgcaaggaaatagggccgatcgccacgccggacgtgctgcactggacagac
tctctgcctaaaacgcgttcaggtaagatcatgcgtcgcatcctgcgcaaaatcgctgcg
ggtgacaccagtaatctcggggacacctcaaccttggcggacccggccgtagtagacaag
ctattggaagaaaaacaatccatgaaagtaccgtcgtaa

DBGET integrated database retrieval system