KEGG   Serratia plymuthica AS9: SerAS9_0602Help
Entry
SerAS9_0602       CDS       T01503                                 

Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
srr  Serratia plymuthica AS9
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SerAS9_0602
Enzymes [BR:srr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SerAS9_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
667703..669025
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLNEAEIRFFINGIRDNVVSEGQIAALAMTIYFHDMTMPERVALT
MAMRDSGTVLDWKSLSLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFNIFPDDSAFRKIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSADLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAKDDADARAKL
QAVLDNGKAAEVFGRMVAAQQGPTDFVERYDSYLPAATLSKPVYAEKQGIISAMDTRALG
MAVVSLGGGRRRATDNIDYSVGLTGMARLGDKVDTQQPLAVIHANDEESWQQAAEAVRSA
MVLSDKAPEATPVVYKRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctggcacaagaaattattcgtaaaaaacgtgacggtcagccgttgaacgaggcg
gaaatccgctttttcatcaatgggatccgtgacaatgtggtttcagaaggtcagatcgcc
gcgctggcgatgaccatttatttccacgatatgaccatgccggagcgcgtggcgctcacc
atggcgatgcgtgattccggcaccgtgctggattggaaaagcctgtcgttgaacggaccc
ttggtcgacaagcactccaccggcggcgtgggcgatgtcacttcgctgatgctaggccct
atggtggccgcctgcggcggctacgtgccgatgatttccggccgcggtctgggccatacc
ggcggcacgctggacaagctggaagccataccgggttttaacattttcccggacgacagc
gccttccgcaaaattattcaggacgttggcgtggcgattatcggccagaccagctcgctg
gcaccggcggacaagcgtttctacgccacccgcgacatcaccgccaccgtggattctatc
ccgctgattaccgcctctattctggcgaagaagctggcggaagggctggatgcgctggtg
atggacgttaaagtcggctccggcgcctttatgccgacctatgcgctgtcggccgatctg
gcgcaggcgatcgttggcgtggccaatggcgcagggtgcaaaactaccgcgctgctgacc
gacatgaatcaggtactggcctccagcgccggcaatgcggtggaagtacgagaagcggtg
cgtttcctgaccggcgaataccgcaacccgcgcctgctggaagtgacgatggcgctgtgc
gtggaaatgctgctttccggcggcctggcgaaagatgacgccgacgcgcgcgccaagctg
caggcggtgctggacaacggcaaagcggcagaagtgtttggccgcatggtggcggcacag
cagggcccgaccgattttgttgagcgctacgacagctatctgccggcagcgaccctgagc
aaaccggtttacgccgaaaaacagggcattatcagcgcgatggatacccgtgcgctgggc
atggcggtggtatcgctgggcggcggtcgtcgccgcgcgaccgacaatatcgattacagc
gtcggcctgaccggcatggcgcgcctgggcgataaagtggatacccagcaaccgctggcg
gtgatccacgccaacgacgaagagagttggcagcaggcggccgaagcggtacgcagcgct
atggtgctgagcgataaagcgccggaagcgacgccagtggtctataagcgcatcacagaa
tag

DBGET integrated database retrieval system