KEGG   Serratia plymuthica AS9: SerAS9_0690Help
Entry
SerAS9_0690       CDS       T01503                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
srr  Serratia plymuthica AS9
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SerAS9_0690
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SerAS9_0690
Enzymes [BR:srr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SerAS9_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
776095..777582
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPTAPGRALREMTLDSRIAAAGDLFVAVVGHQTDGRRYIPQAIAQGV
AAVIAEAEGQAEDGAITEMHGVPVIYLSQLNQRLSALAGRFYHQPAERLRLVGVTGTNGK
TTTTQLLAQWSQLLGETGAVMGTVGNGLLGQVCPTENTTGSAVDVQHVLNELVDRGATFA
AMEVSSHGLVQNRVAALPFAAAVFTNLSRDHLDYHGDMANYEAAKWSLFAGHEVGQAIIN
ADDEVGQRWLSKLPDAVAVTMQDNLQLGCHGRWLKTTAVSYHDNGATVRFSSSWGDGEIE
SRLMGAFNVSNLLLALATLLSLGYPLDKLVETGNQLQPVCGRMEVFNAPGKPTVVVDYAH
TPDALEKALEAARLHCQGQLWCVFGCGGDRDKGKRPLMGGIAEQFADRVVVTDDNPRTEE
PQAIIADILTGLLDAGRALVIHGRAEAVTSAIMQAKEQDVVLVAGKGHEDYQLVGNRRLD
YSDRTTVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgatttactcgctccatgggtgccgacggcgcccgggcgc
gcgctgcgggaaatgacattagacagccgtattgcggctgccggggatctgtttgtcgcc
gttgttggccatcagacagatggacgccgctatattccgcaggccattgcgcagggtgtt
gcagccgtgattgccgaagctgaaggtcaggcagaagacggcgcaatcacggaaatgcac
ggtgtgccggtaatttatctgagccagcttaaccagcgcctttccgcactggccgggcgt
ttttaccatcaaccggcagagcgcctgcgtctggttggcgtgaccggaaccaacggtaaa
accaccaccacgcaactgctggcgcagtggagccaactgttgggtgaaaccggcgcagtg
atgggcaccgtcggtaacggtctgctgggccaggtgtgcccgacggagaataccaccggt
tctgcggtggatgttcaacacgtattaaacgagctggtcgatcggggcgcaacttttgcc
gcgatggaagtctcttctcacgggttggtgcaaaaccgcgtggcggcgctgccgtttgcc
gcagcggtgttcaccaacctgagccgcgatcacctggattaccacggtgatatggccaat
tacgaagcggccaaatggtcgttgtttgccggccacgaagtggggcaggcgatcatcaac
gccgatgacgaagtgggccagcgctggctgagcaaattgccggatgcggtggcggtcacc
atgcaggataacctgcaactgggttgccatggccgctggttgaaaaccactgcggtcagt
tatcacgataatggcgccactgttcgcttcagctcaagctggggcgacggcgaaattgag
agccgcctgatgggcgctttcaacgtcagcaacctgttgctggcactggcgacgctgctg
tcactgggctatccgctggacaaactggtggaaaccggcaatcagctgcagccggtatgc
ggccgtatggaagtattcaacgcgccaggcaaacctacggtcgtggtggattatgcccac
accccggacgcgctggagaaggcgctggaagctgcgcgcctgcactgccaagggcagctg
tggtgcgtgttcggttgcggcggcgatcgtgacaaaggcaagcgcccgctgatgggtggc
atcgccgagcagttcgccgatcgcgtagtggtgaccgatgacaacccgcgtaccgaagag
ccgcaggcgatcattgccgatatcctgaccggtctgctggatgccgggcgtgctctggtg
atccacggccgtgccgaagcggtgaccagcgcgattatgcaagccaaagaacaagatgtg
gtgctggtggcgggtaaaggccacgaggactaccaactggtggggaaccgccgcctggat
tactccgatcgcaccaccgttgcgcgtctgctgggggtaatagcatga

DBGET integrated database retrieval system