KEGG   Serratia plymuthica AS9: SerAS9_0892Help
Entry
SerAS9_0892       CDS       T01503                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
srr  Serratia plymuthica AS9
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:srr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:srr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
990446..991549
Genome map
AA seq 367 aa AA seqDB search
MNGSQTLVVKLGTSVLTGGSLRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADLEDRERFLNARDT
MTALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLYTADPR
NNPQAELIREVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDVIIAAGSKPG
VVGDVIEGKPVGTRFHALETPLENRKRWIFGAPPAGEITVDDGAVEAIMARGSSLLPKGV
REVKGDFSRGEVIRIRNLAGRDLAHGVSRYNSDAMRMIAGHHSQEISEILGYEYGPVVVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagccagacattggttgtgaaattgggcaccagcgtgttgaccggcggatcg
ctgcgtcttaaccgtgcccatattgtcgaactggtacgccagtgcgcacaacagcatgca
gcgggtcaccgcatcgttattgtcacctctggcgcgattgccgccgggcgcgaacatttg
ggctaccccgaactccccgccaccatcgcctccaagcagctgcttgcggcggtcggccag
agccggttgatccaactgtgggaacagctgttctccatttatggcatccacgtcgggcag
atgctgctgacgcgcgccgatctggaagaccgcgaacgcttcctcaacgcgcgtgacacc
atgaccgcgctgctggacaaccgtatcgtgccggtaatcaatgagaatgacgcggtagcg
accgcagaaatcaaggtgggcgacaacgacaacctgtcggcgctggcggcgatcctggcc
ggggccgacaaactgctgctgctgaccgatcaacaaggcctgtataccgccgacccgcgc
aacaacccgcaggcggaactgatccgcgaagtgcatggcattgacgacgcgctgcgcgcc
atcgccggcgacagcgtttccgggttgggcacaggcggcatgggcaccaaattgcaggcg
gccgacgtggcctgccgcgccggtatcgacgtgatcatcgccgcaggcagcaagccgggc
gtggtgggcgacgtgattgaaggcaaaccggtgggcacccgtttccacgcgctggaaacc
ccgctggaaaaccgcaaacgctggatcttcggcgcaccgccggccggtgaaatcaccgtg
gacgacggcgcggtcgaggccattatggcgcgcggcagctcgttgctgccgaagggcgtt
cgcgaagtgaagggcgatttctctcgtggcgaagtgatccgcatccgcaacctggcgggg
cgcgatttggcgcacggcgtcagccgctataacagcgacgcgatgcgcatgattgccggc
caccactcgcaggaaatcagcgaaattctcggttacgaatacggcccggtggtagtgcac
cgcgacgacatgattgtgagctaa

DBGET integrated database retrieval system