KEGG   Serratia plymuthica AS9: SerAS9_1065Help
Entry
SerAS9_1065       CDS       T01503                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
srr  Serratia plymuthica AS9
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:srr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SerAS9_1065
DNA repair and recombination proteins [BR:srr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SerAS9_1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1170364..1170969
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLETLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDICTICANPRRLQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPMDGIGP
GDIGLDRLEQRLEKESITEVILATNPTVEGDATANYIAEMCGQYGVVASRIAHGVPVGGE
LEMVDGTTLSHSLAGRNVIKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctccttgaaacattaatggaggcgttgcgctgcctgccgggcgtt
ggcccgaagtcagcccagcgcatggcgttccagctgctgcagcgcgatcgcagcggcgga
atgcgcttggcgcaggcgctgacccgagccatgtcggaaattggccactgtgccgattgc
cgcactttcaccgagcaggatatctgcaccatttgcgccaatccacgccgtctgcaaaac
ggccagatctgcgtggtggaaagcccggctgatattcacgccattgagcagaccggtcag
ttcgccgggcgctactttgtgctgatgggccacctgtcgccgatggacggcatcgggcct
ggcgatatcggtctggatcggttggagcaacggctggaaaaggaaagcattaccgaagtg
atcctggccactaacccgacggtggaaggcgacgcaaccgccaactacatcgccgagatg
tgcggccagtatggcgtggtcgccagccgcattgcccacggcgtgccggtaggcggcgag
ttggagatggtcgacggcaccacgctgtcgcattcgctggccggccgcaacgtcatcaag
ttttaa

DBGET integrated database retrieval system