KEGG   Serratia plymuthica AS9: SerAS9_1086Help
Entry
SerAS9_1086       CDS       T01503                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
srr  Serratia plymuthica AS9
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SerAS9_1086
Enzymes [BR:srr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SerAS9_1086
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SerAS9_1086
Lipid biosynthesis proteins [BR:srr01004]
 Fatty acid synthase
  Component type
   SerAS9_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1196737..1197333)
Genome map
AA seq 198 aa AA seqDB search
MLLGLFSLRAVAADTLLILGDSLSAGYRLPVAQAWPTLLADQWQKKPGDPQLVNASISGD
TAAQGLARLPALLKQHQPRWVLIELGANDGLRGFPAQDVQRDLSQIITLVQQAGAQPLLM
QIHIPPNYGRRYTEAFSAIYPQLARQFNIPLLPFYMEQVVIKAEWMQDDGLHPNKDAQPF
IATWMAERLEPLVKHESN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgctgttgggattattcagtttacgcgctgtcgccgccgataccttattgattttaggc
gacagtttaagcgccggttaccgcttgccggtggcgcaggcctggccgacgctgctggcc
gaccaatggcagaaaaaaccgggcgatccgcagttggtgaacgccagcatcagcggcgac
accgccgcacaagggctggcgcgcttgcccgccctgctgaaacaacaccaaccgcgctgg
gtgctgatcgaactgggcgccaacgacggtctgcgcggttttccggcgcaggacgtacaa
cgcgatctcagccagatcattaccctggtgcagcaggccggtgcgcagccgctgctgatg
caaatccacattccgcccaactatggccgccgctataccgaggctttcagcgcgatttat
ccgcagcttgccaggcaattcaacattccgctgctgccgttctacatggaacaggtggtg
atcaaagcggaatggatgcaggatgacggattgcatcccaataaggacgcccaaccgttt
atcgccacctggatggcggaacgcctggaacctctagtaaaacatgagtctaactaa

DBGET integrated database retrieval system