KEGG   Serratia plymuthica AS9: SerAS9_1086Help
Entry
SerAS9_1086       CDS       T01503                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
srr  Serratia plymuthica AS9
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:srr01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1196737..1197333)
Genome map
AA seq 198 aa AA seqDB search
MLLGLFSLRAVAADTLLILGDSLSAGYRLPVAQAWPTLLADQWQKKPGDPQLVNASISGD
TAAQGLARLPALLKQHQPRWVLIELGANDGLRGFPAQDVQRDLSQIITLVQQAGAQPLLM
QIHIPPNYGRRYTEAFSAIYPQLARQFNIPLLPFYMEQVVIKAEWMQDDGLHPNKDAQPF
IATWMAERLEPLVKHESN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgctgttgggattattcagtttacgcgctgtcgccgccgataccttattgattttaggc
gacagtttaagcgccggttaccgcttgccggtggcgcaggcctggccgacgctgctggcc
gaccaatggcagaaaaaaccgggcgatccgcagttggtgaacgccagcatcagcggcgac
accgccgcacaagggctggcgcgcttgcccgccctgctgaaacaacaccaaccgcgctgg
gtgctgatcgaactgggcgccaacgacggtctgcgcggttttccggcgcaggacgtacaa
cgcgatctcagccagatcattaccctggtgcagcaggccggtgcgcagccgctgctgatg
caaatccacattccgcccaactatggccgccgctataccgaggctttcagcgcgatttat
ccgcagcttgccaggcaattcaacattccgctgctgccgttctacatggaacaggtggtg
atcaaagcggaatggatgcaggatgacggattgcatcccaataaggacgcccaaccgttt
atcgccacctggatggcggaacgcctggaacctctagtaaaacatgagtctaactaa

DBGET integrated database retrieval system