KEGG   Serratia plymuthica AS9: SerAS9_1200Help
Entry
SerAS9_1200       CDS       T01503                                 

Definition
PTS system N-acetylglucosamine-specific transporter subunit IIBC (EC:2.7.1.69)
Orthology
K02802  
PTS system, N-acetylglucosamine-specific IIA component [EC:2.7.1.69]
K02803  
PTS system, N-acetylglucosamine-specific IIB component [EC:2.7.1.69]
K02804  
PTS system, N-acetylglucosamine-specific IIC component
Organism
srr  Serratia plymuthica AS9
Pathway
Amino sugar and nucleotide sugar metabolism
Phosphotransferase system (PTS)
Module
PTS system, N-acetylglucosamine-specific II component
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SerAS9_1200
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    SerAS9_1200
Enzymes [BR:srr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     SerAS9_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1312343..1314379
Genome map
AA seq 678 aa AA seqDB search
MNILSYLQKVGRALMVPVATLPAAAILMGVGYWIDPTGWGASNALAAFFIKSGSAIIEHM
SVLFAVGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVSMIQKIPLDQVPAAFGKIEN
QFVGILVGIISAEVYNRFSSVELPKALSFFSGRRLVPILISFLMILVAFILMYLWPMIFG
GLVNFGEHIQKLGSAGAGIYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPNFLGGQQSI
ESGKAVVGITGRYQAGFFPIMMFGLPGAALAIYHCARPENKAKVLGIMMAGAFAAFFTGI
TEPLEFSFMFVAPVLYVIHAILTGISVYIAASMHWIAGFGFSAGLVDMVLSSRNPLATHW
YMLIPQGLVFFAIYYVVFRFTINKFNLMTPGRELAVAGDETDGYDVNVGTDGGKDENETT
TLARRYVGAIGGSDNLTGIDACITRLRLNVKDSALVNDAVAKRLGASGVIRLNKQSVQVI
VGTRAELIASAMRNVVAAGPIAATVAPAAAPVAEAKPQAVPNAPKVAFETLVAPVTGEVV
ALDQVPDEAFASKAVGDGLAIRPTDKTVVAPADGTIVKIFNTNHAFCLETDKGAEIVVHM
GIDTVALNGQGFKRLVEEGAEVKAGQPILELDLDYLNANARSMISPVVVSNSDDYAGLAA
LATGSVVAGQTKLFDIQK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
gtgaacattcttagttatttgcaaaaagtgggccgcgccttgatggtgccggtcgccacg
ctgcccgccgccgcgatcttgatgggcgtcgggtattggattgaccctactggttggggc
gcctctaacgctctcgctgctttctttattaaatccggttctgccattatcgaacacatg
tcggtgctgttcgccgtcggtgtggcttacggcatgtccaaagacaaggacggcgccgct
gcgctgaccggctttgtcggcttcctggtattaaccaccctgtgttcaccggccgccgtg
tcgatgattcagaaaattcccctcgaccaggtgcctgccgcgtttggcaagattgagaac
cagttcgtcggtattctggtgggtatcatctccgccgaagtctacaaccgctttagcagc
gttgagctgccgaaggcgctgtcgttcttcagcggccgccgtctggtgcctatcctgatc
tccttcctgatgatcctggtggccttcatcctgatgtatctctggccgatgatcttcggt
ggtctggttaacttcggtgaacacattcagaagttgggctccgccggtgcaggtatttat
gcgttctttaaccgtctgctgatcccggtcggcctgcatcatgcgttgaactcggtgttc
tggttcgacgtagccggcattaacgacatccctaacttccttggcggccagcagtctatc
gaatccggtaaagcggttgtcggcatcaccggccgttatcaggcgggcttcttccctatc
atgatgttcggtctgccgggtgcggcgctggctatctatcactgcgcacgtccggaaaac
aaagccaaagtgctgggtatcatgatggcgggcgcctttgccgccttcttcaccgggatc
accgaaccgctggaattctccttcatgttcgtggctccagtgttgtatgtgatccacgcg
atactgaccggtatttcggtatacatcgccgccagcatgcactggattgccggtttcggc
ttcagcgccggtctggtggatatggtgctgtcgtcacgtaacccattggcgacccactgg
tacatgctgatcccgcagggcctggtgttcttcgccatttactacgtggtgttccgcttc
accatcaacaagttcaacctgatgaccccagggcgcgaactggcggttgccggtgacgaa
accgacggttatgacgtcaacgtcggtaccgacggcggtaaagacgaaaacgaaaccact
accctggcacgccgttacgtgggcgccatcggcggttctgacaacctgaccggcatcgac
gcttgtatcacccgtctgcgtctgaacgtgaaagactctgcgctggtgaacgacgcggtg
gcgaaacgtctgggcgcttccggggtgatccgcctgaacaaacaaagtgtgcaagtgatt
gtcggcacccgtgcggagctgattgccagcgccatgcgcaacgtggtcgccgcaggtccg
atagctgccactgtagcgccggctgccgcgcctgttgctgaagccaagccgcaagcagtg
cctaatgcgccgaaggtggcttttgagacgctggtggccccggtgaccggtgaagtcgtg
gccctggatcaggtacctgacgaagcctttgccagcaaagcggtaggcgatggcctggcg
attcgcccaacggataaaaccgtcgtggcgccggctgacggcaccatcgtgaaaatcttc
aacaccaaccacgccttctgcctggaaaccgacaagggcgcggagatcgtggtgcacatg
ggtatcgataccgtagcgctgaacggtcagggcttcaaacgtctggtagaagagggcgct
gaggtgaaagccggccagccgattcttgagctggatctggactacctgaacgccaatgcc
cgttcgatgataagcccggtggtggtcagcaactctgacgactacgcaggtctggcggcg
ctggcgaccggttccgtggtggccggccagaccaagctgttcgacatccagaagtaa

DBGET integrated database retrieval system