KEGG   Serratia plymuthica AS9: SerAS9_1236Help
Entry
SerAS9_1236       CDS       T01503                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
srr  Serratia plymuthica AS9
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:srr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:srr00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:srr00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:srr00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1352200..1352547
Genome map
AA seq 115 aa AA seqDB search
MVNNVSALGRNGVHDWLLLRASAIVITLYVLYILGFFVTAPDLTYEIWRGFFATSITKVF
TLLTLLSILVHAWVGLWQVLTDYVKPLAVRLVLQLAIVVVLLVYLLYGTIVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtttctgcattagggcgcaacggcgtacacgactggttgttactgcgt
gcttccgctatcgtcatcaccctgtacgtgctgtatatcctgggcttcttcgttacggct
ccggatctcacctatgaaatctggcgcggcttcttcgccacctctattacgaaagtgttc
acgctgctgacgctgctgtcgattctggttcacgcctgggtcggtttgtggcaggtgctg
acggactacgtcaaaccgctggcagtgcgtctggtgttgcaactggcgatcgttgtcgtg
ttgctggtctatttactgtacggaacaatcgtagtgtggggtgtgtaa

DBGET integrated database retrieval system