KEGG   Serratia plymuthica AS9: SerAS9_1241Help
Entry
SerAS9_1241       CDS       T01503                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00020  Citrate cycle (TCA cycle)
srr00640  Propanoate metabolism
srr00660  C5-Branched dibasic acid metabolism
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01120  Microbial metabolism in diverse environments
srr01130  Biosynthesis of antibiotics
srr01200  Carbon metabolism
Module
srr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS9_1241
   00640 Propanoate metabolism
    SerAS9_1241
   00660 C5-Branched dibasic acid metabolism
    SerAS9_1241
Enzymes [BR:srr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SerAS9_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEF44379
JGI: SerAS9_1241
Position
1359608..1360774
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAEAWLGKRLVTYQTDALGQPVHQILVEAATDIDKELYLGAVVDRASRR
VVFMASTEGGVEIEKVAEETPELIHKMTIDPLAGPQPYQGRELAFKLGLTGKQVGQFAKI
FMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNALFRQSELREMRDPSQEDE
RESRAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacagctgtttgctcggtatggcatgccggcacca
accggttacgcctgtaccacaccgcgtgaagcagaagaagccgcatccaaaatcggctcc
ggcccgtgggtggtaaaatgtcaggttcatgctggcggtcgcggtaaagctggcggcgtt
aaagtggttaacagcaaagaagacatccgtgctttcgctgaagcctggctgggcaagcgt
ctggtgacctaccagactgacgcgctgggccaaccggtccaccagatcctggtagaagcg
gcgaccgacatcgataaagaactgtatctgggtgcggtagttgaccgtgcaagccgtcgc
gtggtgtttatggcatccaccgaaggtggcgttgagattgaaaaagttgcggaagaaacc
ccggaactgatccacaaaatgaccatcgacccactggcaggcccacagccttaccagggc
cgtgagttggccttcaaactgggtctgaccggcaagcaagtcggtcagttcgccaagatc
ttcatgggtttggcgaccttgttcctggagcgcgacctggcgatggttgagatcaacccg
ctggtagtcaccaagcagggcgatctgatctgcctggacggcaaactgggtgccgacggc
aacgcactgttccgccagtctgaactgcgtgaaatgcgtgacccttctcaggaagatgag
cgtgaatcccgcgctgcacagtgggagctgaactacgttgctctcgacggcaacatcggt
tgcatggttaacggcgcaggtctggcgatgggtaccatggacatcgttaaactgcacggc
ggcgaaccggccaacttcctcgacgtaggcggcggcgcgaccaaagagcgcgtgactgaa
gcgttcaaaatcatcctgtctgacgacaaggtgaaagcggttctggttaacattttcggt
ggtatcgtacgctgcgatctgatcgccgacggcatcattggcgcagtcgccgaagtgggc
gttaacgtccctgtggtcgtgcgtctggaagggaacaatgccgaactgggcgccaagaaa
ctggcggacagcggtctgaatatcattgctgcgaccagcctgactgatgcggctcagcaa
gttgttgcggcagtggagggtaaataa

DBGET integrated database retrieval system