KEGG   Serratia plymuthica AS9: SerAS9_1261Help
Entry
SerAS9_1261       CDS       T01503                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
srr  Serratia plymuthica AS9
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SerAS9_1261
   01230 Biosynthesis of amino acids
    SerAS9_1261
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS9_1261
  Energy metabolism
   00680 Methane metabolism
    SerAS9_1261
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SerAS9_1261
Enzymes [BR:srr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SerAS9_1261
Exosome [BR:srr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SerAS9_1261
  Exosomal proteins of melanoma cells
   SerAS9_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(1382698..1383450)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRTEAKAAGKLLKDEGFSFDFAYTSVL
KRAIHTLWNILDELDQAWLPTEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYSALTEKELPLTESLALTIDRVIPYWDEEILPRIKSGERVI
VAAHGNSLRALVKYLDKLSEDEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgtcacggcgaaagccagtggaacaacgaaaac
cgctttaccggttggtatgatgttgatttgtccgacaaaggtcgcaccgaagcgaaagca
gcaggcaagctgttgaaagatgaaggtttctcttttgactttgcttacacctccgtcctg
aagcgcgcgatccataccctgtggaacattctggacgaactggatcaggcttggctgccg
actgaaaaatcctggaagctgaacgaacgccactacggtgcgctgcagggtctgaacaag
gctgaaaccgctgaaaaatacggtgacgagcaggttaagcaatggcgtcgcggcttcgcc
gttaccccaccagagctgaccaaagatgatgagcgttacccgggccacgatccacgttac
tcagcgctgaccgaaaaagagctgccgctgaccgaaagcctggcgctgactattgatcgc
gtgatcccttactgggacgaagaaattctgccgcgcatcaaaagcggcgagcgcgttatc
gttgccgctcacggcaactcgctgcgtgcgctggtgaaatacctggataagctgagcgaa
gatgagatcctcgaactgaacatcccaaccggcgtgccgttggtgtatgaattcgacgaa
aacttcaagccaatcaaacgttactacctgggcaatgccgacgagatcgctgctaaagcg
gccgccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system