KEGG   Serratia plymuthica AS9: SerAS9_1529Help
Entry
SerAS9_1529       CDS       T01503                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
srr  Serratia plymuthica AS9
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SerAS9_1529
Enzymes [BR:srr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SerAS9_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1642242..1642907
Genome map
AA seq 221 aa AA seqDB search
MTSLSKEAALVHAALEERGLETPLRGEVLDRETRKRRIKEHMTEIMQLLNLDLSDDSLAE
TPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDAVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHQG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattaagtaaagaagctgccctggttcacgcagcgctcgaagagcgtggtctg
gaaaccccgttgcgcggtgaagtgctggatcgcgaaacgcgcaaacgtcgtattaaagag
cacatgacggaaatcatgcagctgcttaatctcgacctgtccgacgacagcctggcagaa
accccgcaccgcattgccaaaatgtatgtcgatgagattttctccggcctggactacgcc
aacttcccaaaaatcaccgttatcgaaaacaagatgaaggtagatgaaatggtgacggtg
cgcgatatcacactgaccagcacctgcgagcatcacttcgtgaccatcgacggcaaagcg
accgtggcctatattccgaaagatgcggtgattggtctgtcgaaaatcaaccgtatcgtg
cagttcttctcccagcgcccccaggtgcaggagcgtttgactcagcagatcctggtggca
ttgcaaaccttgctcggcaccaataacgtggcggtatcgattgatgcggtccattattgt
gttaaggcacgcggcatccgtgacgcgaccagcgccaccaccaccacctctctgggcggg
ctgttcaagtccagccagaacacgcgccaggagtttttgcgcgcggtacgtcatcaccag
gggtga

DBGET integrated database retrieval system