KEGG   Serratia plymuthica AS9: SerAS9_1529Help
Entry
SerAS9_1529       CDS       T01503                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00790  Folate biosynthesis
srr01100  Metabolic pathways
Module
srr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SerAS9_1529
Enzymes [BR:srr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SerAS9_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEF44664
JGI: SerAS9_1529
Position
1642242..1642907
Genome map
AA seq 221 aa AA seqDB search
MTSLSKEAALVHAALEERGLETPLRGEVLDRETRKRRIKEHMTEIMQLLNLDLSDDSLAE
TPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDAVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHQG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattaagtaaagaagctgccctggttcacgcagcgctcgaagagcgtggtctg
gaaaccccgttgcgcggtgaagtgctggatcgcgaaacgcgcaaacgtcgtattaaagag
cacatgacggaaatcatgcagctgcttaatctcgacctgtccgacgacagcctggcagaa
accccgcaccgcattgccaaaatgtatgtcgatgagattttctccggcctggactacgcc
aacttcccaaaaatcaccgttatcgaaaacaagatgaaggtagatgaaatggtgacggtg
cgcgatatcacactgaccagcacctgcgagcatcacttcgtgaccatcgacggcaaagcg
accgtggcctatattccgaaagatgcggtgattggtctgtcgaaaatcaaccgtatcgtg
cagttcttctcccagcgcccccaggtgcaggagcgtttgactcagcagatcctggtggca
ttgcaaaccttgctcggcaccaataacgtggcggtatcgattgatgcggtccattattgt
gttaaggcacgcggcatccgtgacgcgaccagcgccaccaccaccacctctctgggcggg
ctgttcaagtccagccagaacacgcgccaggagtttttgcgcgcggtacgtcatcaccag
gggtga

DBGET integrated database retrieval system