KEGG   Serratia plymuthica AS9: SerAS9_1551Help
Entry
SerAS9_1551       CDS       T01503                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
srr  Serratia plymuthica AS9
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SerAS9_1551
   00052 Galactose metabolism
    SerAS9_1551
   00500 Starch and sucrose metabolism
    SerAS9_1551
   00520 Amino sugar and nucleotide sugar metabolism
    SerAS9_1551
Enzymes [BR:srr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SerAS9_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1670365..1671264
Genome map
AA seq 299 aa AA seqDB search
MQKRLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVNECVAAGIKDIVLVTHSS
KNAIENHFDTSFELEAVLESRVKRQLLEEVQTICPADVTVMQVRQGQAKGLGHAVLCAKP
MIGDEPFIVLLPDVLLDDSTADLRKENLAKMIQRFADTGFSQIMVEPVPEQDVSKYGVVD
CGGATLAAGASTPMTAVVEKPTREEAPSNLAVVGRYVLSADIWPLLEKTLPGAGDEIQLT
DAIAALMEQETVEAFHMSGKSHDCGDKLGYMKAFVQYGLRHASEGEDFTQWLKQTLNSK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagagactgaaggccgtgattcccgtagctggcttgggaacccgtatgttgccg
gcaacaaaagccatccctaaagaaatgttgcctgtggtcgataagccgctaatccaatac
atcgttaacgaatgtgttgctgcggggataaaagatatcgttctggtgactcactcctcc
aaaaatgcgattgagaaccacttcgatacctcctttgagctcgaagccgttttggagtcg
cgtgttaagcgccagctgctggaagaagtgcaaaccatctgtccagcagacgtgacggtg
atgcaagtccgtcagggccaagcgaaaggtctgggacacgcggtactctgcgccaaacca
atgatcggcgatgagccttttatcgtgttattgccggatgtattgctggatgactctacc
gccgatctgcgtaaagaaaacctggccaaaatgattcagcgttttgcggatactggcttc
agtcaaatcatggtggaaccagtaccggaacaagacgtgtcgaaatacggcgttgtagat
tgcggcggtgctactctggcagcaggtgcaagcacaccaatgactgctgtggtcgaaaag
ccgacaagagaagaagccccttccaatctggcagtggtagggcgttatgtgttgtctgcg
gatatctggcctttgctggaaaaaaccttgccgggggccggtgatgaaattcagcttact
gatgcgattgccgccctgatggagcaggaaaccgtagaagctttccatatgagcggcaaa
tcgcacgactgcggcgataagttgggctatatgaaagcgttcgtacaatatggcctgcgt
catgcttcggaaggtgaagattttacccaatggctgaagcagacattgaacagtaaataa

DBGET integrated database retrieval system