KEGG   Serratia plymuthica AS9: SerAS9_1552Help
Entry
SerAS9_1552       CDS       T01503                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
srr  Serratia plymuthica AS9
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:srr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:srr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:srr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:srr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1671305..1672201
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMRMLPATKAIPKEMLPIVDKPLIQYIVNECVAAGIKEIILVTHSSK
NAIENHFDTSFELEAMLEARVKRQLLDEVQSITPKGVTLMHIRQGQPKGLGHAVLCAKPL
VGDSPFVVLLPDVLLDDAKADLKKDNLPHMIARFEQSGLSQVLVQAADEHVLHDYSVVEC
ETNNLKPGESSRMTSIIEKPGRDVQFKSNYSAVGRYVLSADIWPILEKTEPGAWGRIQLT
DAIAELLKHKPVEAMELIGESFNCGEKMGYLRAFVTYGLRHPTQGKEFLAWAKKLSLS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagttgaaagctgtcattcctgttgccggcctgggtatgcgcatgttgcctgca
accaaggctattcccaaagagatgttgccgatcgttgataagcccttgattcaatacatt
gtcaatgagtgcgttgctgccggaattaaagaaatcattctggtgactcattcctccaag
aatgcgatcgaaaaccattttgatacctcttttgagttggaagcgatgcttgaggcgcgc
gtaaaacgtcaactactggatgaggtacagtcgattacgcctaaaggcgtgacgttgatg
cacatccgtcagggccaacctaagggcttgggccatgcagtgttgtgcgccaaacctttg
gtgggtgactcaccgtttgtcgtgctgttgccggacgtgctgcttgatgacgcaaaagcc
gatcttaagaaagataacctgccgcacatgattgctcgctttgaacagtcgggattgagc
caggtgctggtgcaggcggctgatgagcatgtgctgcacgattactcggtcgttgaatgc
gagaccaacaatttgaaacccggtgaaagttcccgcatgacttctatcatcgaaaaaccg
ggtcgtgacgttcagtttaaatccaattattcggcggtagggcgctatgttctgtccgcc
gatatttggcctattctggaaaaaacagagccaggtgcgtggggacgtattcaacttaca
gatgccattgctgaactgctaaaacacaaaccggttgaagcgatggagttgattggagag
tcattcaactgcggagaaaaaatgggctatttgcgggcgtttgttacctatggtttacgc
caccctacacagggaaaagagtttttagcatgggctaagaaattatcattgtcgtaa

DBGET integrated database retrieval system