KEGG   Serratia plymuthica AS9: SerAS9_1872Help
Entry
SerAS9_1872       CDS       T01503                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
srr  Serratia plymuthica AS9
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:srr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:srr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2023549..2024580
Genome map
AA seq 343 aa AA seqDB search
MGPVMLDVASYELDAEEREILKHPLVGGLILFTRNFHDAQQLRELVRQIREASHDRLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALNEAHEGGRLAQEAGWLMAAEMIAQDIDISFAPV
LDIGHVSAAIGERSFHSDPQQALAMAERFILGMHSAGMKTTGKHFPGHGAVSADSHKETP
RDPRPLAQIREHDMAIFRELINRQLLDAVMPAHVIYTEADPRPASGSPYWLQQILRQELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSPVKADRV
KQLYHRGQFTRQELRDSARWQQAHKELSALSERWEEHKQQSAG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtaatgttagatgtcgccagctatgagctggatgccgaagaacgtgagatt
ttaaaacacccgctggtgggcggacttatcctgttcacccgcaacttccacgatgcgcag
cagttgcgtgaactggtgcgccaaatccgcgaggcttcacacgatcggctggtggtggcg
gtggatcaggaaggcgggcgcgtccagcgtttccgcgaagggttcacccgcctgccggcg
gcgcagtcgttcgctgcattgaacgaagcccatgagggcgggcgtctggcgcaagaggcc
ggctggctgatggcggcggaaatgatcgcgcaggatatcgacatcagcttcgcgccggtg
ctggatatcggccacgtcagcgcggcgattggcgaacgctcattccacagcgatccgcaa
caggcgctggcgatggccgagcgttttatcctgggtatgcacagcgccgggatgaaaacc
accggcaagcatttccctggccatggcgccgtcagtgcagattcacataaagaaaccccg
cgcgatccacgcccactggcgcagatccgtgagcatgatatggcgatcttccgtgaattg
atcaaccgtcagttgctggacgccgtgatgccggcgcacgtcatctatactgaagcggac
ccgcgtccggccagtggttcgccatactggttgcaacaaatcctgcgtcaggagctgggc
tttgacggcgttatcttctccgacgatctgtcgatggaaggggccgccatcatgggcagt
tatgctgagcgcggccaggcatcgctggatgccggctgtgacatgatcctggtgtgcaat
aaccgccagggtgcggtcagcgtgctggataacctgtccccggtcaaagcagaccgggtg
aagcagttatatcatcgcggtcagttcacccgtcaggaattgcgtgattctgcgcgctgg
cagcaggcgcataaagagctgagcgcgctcagcgaacgctgggaagagcataagcagcaa
agtgccgggtga

DBGET integrated database retrieval system