KEGG   Serratia plymuthica AS9: SerAS9_2030Help
Entry
SerAS9_2030       CDS       T01503                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00340  Histidine metabolism
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01230  Biosynthesis of amino acids
Module
srr_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SerAS9_2030
Enzymes [BR:srr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SerAS9_2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEF45156
JGI: SerAS9_2030
Position
complement(2182090..2183418)
Genome map
AA seq 442 aa AA seqDB search
MSHTVTFHDLSHSRQLPEALFQRTEADLSFFIERVQPIIAAVRSEGDAALQRFAREFDGV
QAERMSIRVEQSEFDDAMARLDPTVTAAIAYAAGNIRAFHEAQKPEEMWLKEMQPGAFAG
DRHLPIDSVACYVPRGKGSFPSVLLMTAIPALVAGVPRPVVITPPGPDGRVDDATLVAAQ
LVGIREIYKCGGAQGVAAVAYGTETVPKCLKIVGPGSPWVVAAKRQLAQLIDPGVPAGPS
ESIILADDSANGALAALDLIIESEHGPDSSAWLVTSSRRVAEQAIAALPGYWAQLDEKRA
GFSQSVLCGAHGGVVLTQDFAAAVAFVNGYAPEHLEILAEEPLAVMGQIRNAGEILLGNY
TPVTLGNFVLGPNAVLPTNAAAKVAGPLSVFDYMKRISVGYVTRSGYDALAEKAHGFALY
EGFPAHALAVSPLRKTLLDRQS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacacagtgacctttcacgatctcagccacagccggcaattgccggaagccctg
ttccaacgcaccgaagccgacttgtcgttctttatcgaacgggtgcagccgattatcgcg
gcggtccgcagtgaaggcgatgccgcgctacaacgcttcgcacgggaattcgatggcgtg
caggccgagcggatgtcgattcgcgtcgaacagagcgagttcgacgacgccatggcgcgg
ctggatcccaccgtcaccgccgctatcgcctatgccgccggcaatatccgcgcgtttcac
gaagcgcagaaaccggaagaaatgtggttgaaagagatgcagcccggcgcttttgccggc
gatcgccacctgccgatcgattccgtagcctgctatgtgccgcgcggcaaaggttcgttc
cccagcgtgctgctgatgacggcgatcccggcgctggtggccggcgtacccaggccggtg
gtgattaccccgcccggcccggatggcagagtcgatgatgccacgctggtggcggcgcag
ttggtcggcatccgcgaaatttacaagtgcggcggcgcacagggggtagcggccgtggct
tatggcactgaaacggtgccaaagtgcctgaagatcgtcggccccggcagcccctgggtg
gtggccgccaaacgtcagttggcgcagttgatcgatcccggcgtgccggccggccccagc
gaaagcattattttggccgatgacagcgccaacggtgcgctggcggcgttggacttgatc
attgaatcggaacatggcccggactcctccgcctggctggtgacctccagccgccgggta
gccgaacaggcgatcgccgcgctgccgggttactgggcgcaactggacgagaaacgcgcc
ggcttctcgcaaagcgtgctgtgcggtgcccacggcggtgtggtgctgacgcaggacttc
gccgccgcagttgcgtttgttaacggctacgcaccggaacacctggagatcctggcggaa
gagccgctggcggtgatgggccaaattcgcaacgccggtgaaatcctgctgggcaattac
accccggtgacgttaggcaactttgtgctcggccccaatgcggtgctgccgaccaatgcc
gccgccaaagtggccgggccgctgtcggtattcgactacatgaagcgtatttcggtgggt
tatgtcacccgcagcggttacgacgcgttggcggaaaaggcgcacgggtttgccctgtat
gaaggcttccccgcacacgcgctggcggtgtcaccgctgcgtaaaaccctgctcgatcgt
cagtcctga

DBGET integrated database retrieval system