KEGG   Serratia plymuthica AS9: SerAS9_2113Help
Entry
SerAS9_2113       CDS       T01503                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
srr  Serratia plymuthica AS9
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SerAS9_2113
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SerAS9_2113
Enzymes [BR:srr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SerAS9_2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2268729..2269214)
Genome map
AA seq 161 aa AA seqDB search
MSHSLLSIPCVTLQGEHKTLGDFPARAYLVVNTASKCGFTPQYRGLENLWQYYRDRGLMV
LGFPCNQFGAQEPGDPLEIANFCTLNYGVSFPLFSKVEVNGPGTHPLFNELKRLGPGVLG
SKRIKWNFTKFLLTADGQRVKRFAPITKPERLFDHIETLLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagccattcactgttatccatcccctgtgtcactctgcaaggggaacacaaaacgctc
ggcgactttcccgcccgcgcttatctggtggttaatactgccagcaaatgcggctttact
ccgcaataccgtggcctggaaaatctgtggcagtactatcgggatcgcggcctgatggtg
ttggggttcccgtgcaatcaatttggtgcgcaagagccaggggatccgctggagatcgcc
aatttctgtacgctcaactacggagtcagtttcccgctgttcagcaaggtggaagttaac
ggccccggcacgcatccgctgttcaacgaattgaaacgcctggggccgggggtgctgggc
agcaagcgcatcaagtggaacttcaccaagttcctgctgactgccgacggccagcgggtg
aaacgttttgcgcccatcaccaaacctgagcgtctgtttgaccacatagaaaccctgctg
aaataa

DBGET integrated database retrieval system