KEGG   Serratia plymuthica AS9: SerAS9_2178Help
Entry
SerAS9_2178       CDS       T01503                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
srr  Serratia plymuthica AS9
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SerAS9_2178
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SerAS9_2178
Enzymes [BR:srr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SerAS9_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2335392..2336717)
Genome map
AA seq 441 aa AA seqDB search
MNIEWITSSDTEQWQKCDRLLETIKPANLQLSKLRGRQVEGFGGCFNELGMTALNALDDK
QRHDILDNLFSPEGECRLTLGRVPIGASDYAVSWYSLNEQEEDYAMEHFSIERDKRYLLP
YIKEALARQPNMTLFASPWSPPTWLKTHQACNFGRLRRDERAQKAYALYFKKFIEHYEKE
GVRIAQVHIQNEVVADQKFPSCVWSGEQLKEFIKEYLGPLLMQEPIDSEIWLGTINAPEF
LKEPGQDYDDYANCVLSDPEAYQYVSGVGYQWAGKNAIQRTVMSYPELRYYQTESECGDG
NNSWQYAHYIFGLFRHYLINGANGYFYWNMVLAEGGESTWGWKQNSMISINKETKSVSYN
PEYSVMRHFSRYVVPGARLIPLTGAMSGNAVAFENPDNSVIITINNPSFHKRELRLAIGG
RTVEFTLHENSISTLIVKDYH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaatggatcacatcatctgatacggaacaatggcagaaatgcgaccgtctt
ctagaaacaattaaacccgctaacctgcagctgtccaagctccgtggtcgtcaggtggaa
gggttcggcgggtgcttcaatgaactggggatgacggcgttaaatgctctggacgacaaa
cagcggcacgacatcctggataacctgttttcgccagagggtgaatgtcggcttaccctg
ggacgcgtaccgatcggcgcaagtgattatgccgtatcctggtatagcctcaatgaacaa
gaggaagattacgccatggaacacttttccattgagcgtgacaaacgttatttattgcct
tatataaaagaggcacttgcgcgtcagccaaacatgacgctttttgcctccccctggagc
ccacccacctggctgaaaacacaccaagcctgtaattttggccgtcttcgccgggatgaa
cgggcgcaaaaagcttacgcattatattttaaaaaatttatcgaacactatgagaaagaa
ggtgtgcgcatagcgcaggtacatattcaaaatgaagttgtcgccgatcaaaagttcccc
tcttgtgtctggagcggcgagcagttgaaagagtttataaaagagtatcttggcccactc
ttaatgcaagaacccatagacagcgagatctggttaggaaccatcaatgctccggaattt
ttgaaagagccgggacaagactatgatgactacgccaactgtgtactttccgaccccgaa
gcctaccaatatgttagcggcgtgggttatcagtgggccggtaagaatgccattcaacga
accgtaatgagttaccctgaattacgctattaccaaacagaaagtgaatgtggtgatgga
aataatagctggcagtacgcgcactatatttttggtttgttccgacattacttaatcaat
ggtgccaacggctacttttactggaacatggtgttggctgaagggggggaaagtacctgg
ggttggaagcaaaacagtatgatctccataaataaagaaacaaaatcagtaagttataat
ccagaatatagcgttatgcgtcacttttctcgatacgttgtacctggtgcccggctaata
ccattaaccggtgcaatgagtggtaatgccgttgcgttcgaaaaccctgataactcggtc
atcatcacgataaataacccttcatttcataaaagagaactgaggcttgccattggggga
agaaccgttgagtttacccttcatgaaaactcgataagtacattaatagtaaaagattac
cattaa

DBGET integrated database retrieval system