KEGG   Serratia plymuthica AS9: SerAS9_2261Help
Entry
SerAS9_2261       CDS       T01503                                 

Definition
oligo-1,6-glucosidase (EC:3.2.1.10)
Orthology
K01182  
oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
srr  Serratia plymuthica AS9
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SerAS9_2261
   00500 Starch and sucrose metabolism
    SerAS9_2261
Enzymes [BR:srr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     SerAS9_2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2427789..2429591
Genome map
AA seq 600 aa AA seqDB search
MPRQGLKTALAIFLTTSLCISCQQAFGTQQPLLNEKSIEQSKTIPKWWKEAVFYQVYPRS
FKDTNGDGIGDINGIIEKLDYLKALGIDAIWINPHYDSPNTDNGYDIRDYRKIMKEYGTM
EDFDRLISEMKKRNMRLMIDVVINHTSDQNEWFVKSKSSKDNPYRGYYFWKDAKEGQAPN
NYPSFFGGSAWQKDEKTNQYYLHYFAKQQPDLNWDNPKVRQDLYTMLRFWLDKGVSGLRF
DTVATYSKIPDFPNLTQQQLKNFAAEYTKGPNIHRYVNEMNKEVLSHYDIATAGEIFGVP
LDQSIKFFDRRRDELNIAFTFDLIRLDRDSDQRWRRKDWKLSQFRQIIDNVDRTAGEYGW
NAFFLDNHDNPRAVSHFGDDRPQWREPSAKALATLTLTQRATPFIYQGSELGMTNYPFKA
IDEFDDIEVKGFWHDYVETGKVKADEFLQNVRLTSRDNSRTPFQWDGSKNAGFTSGKPWF
KVNPNYQEINAVSQVTQPDSVFNYYRQLIKIRHDIPALTYGTYTDLDPANDSVYAYTRSL
GAEKYLVVVNFKEQMMRYKLPDNLSIEKVIIDSNSKNVVKKNDSLLELKPWQSGVYKLNQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtcaaggattgaaaactgcactagcgatttttctaaccacatcattatgcatc
tcatgccagcaagccttcggtacgcaacaacccttgcttaacgaaaagagtatcgaacag
tcgaaaaccatacctaaatggtggaaggaggctgttttttatcaggtatatccgcgttcc
tttaaagacaccaacggagatggtatcggggatattaacggcatcatagaaaaattagac
tatctaaaagccttggggattgatgccatttggatcaacccacattatgattctccgaac
acggataatggttacgatatacgtgattatcgaaaaatcatgaaagaatatggcacgatg
gaggattttgaccgcctgatttctgaaatgaaaaaacggaatatgcggttgatgattgat
gtggtcatcaaccacaccagcgatcaaaacgaatggtttgttaaaagtaaaagcagtaag
gataatccttatcgcggctattatttctggaaagatgctaaagaagggcaggcgcctaat
aattacccttcattctttggtggctcggcgtggcaaaaagatgaaaagaccaatcaatac
tacctgcactattttgctaaacaacagcctgacctaaactgggataaccccaaagtccgt
caagatctttatacaatgttacgtttctggttagataaaggcgtgtctggtttacgtttt
gatacggtagcgacctactcaaaaattccggatttcccaaatctcacccaacaacagctg
aagaattttgcagcggagtataccaagggccctaatattcatcgttacgtcaatgaaatg
aataaagaggtcttgtctcattacgacattgcgactgccggtgaaatctttggcgtaccc
ttggatcaatcgataaagttcttcgatcgccgccgtgatgagctgaacattgcatttacc
tttgacttaatcagactcgatcgagactctgatcaaagatggcgtcgaaaagattggaaa
ttgtcgcaattccggcagatcatcgataacgttgaccgtactgcaggagaatatggttgg
aatgccttcttcttggataaccacgacaatccgcgcgctgtctcgcactttggcgatgat
cgcccacaatggcgtgagccatcggctaaggcgcttgcaaccttgacgctgactcaacga
gcaacaccttttatttatcaaggttcagaattgggcatgaccaattacccgtttaaagct
attgatgaattcgatgatattgaggtgaaaggtttttggcatgactacgttgagacagga
aaggtcaaagccgacgagttcttgcaaaatgtacgcctgacgagcagggataacagccgg
acgccgttccaatgggatgggagcaaaaatgcaggattcacgagcggaaaaccttggttc
aaggtcaacccaaactaccaggaaatcaatgcagtaagtcaagtcacacaacccgactca
gtatttaactattatcgtcagttgatcaagataaggcatgacatcccggcactgacctat
ggtacatacaccgatttggatcctgcaaatgattcggtctacgcctatacacgcagcctt
ggggcggaaaaatatcttgttgttgttaacttcaaggagcaaatgatgagatataaatta
ccggataatttatccattgagaaagtgattatagacagcaacagcaaaaacgtggtgaaa
aagaatgattcattactcgagctaaaaccatggcagtcaggggtttataaactaaatcaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system