KEGG   Serratia plymuthica AS9: SerAS9_2282Help
Entry
SerAS9_2282       CDS       T01503                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
srr  Serratia plymuthica AS9
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:srr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2458037..2459449
Genome map
AA seq 470 aa AA seqDB search
MIYQRLDDFPADFLWGASTSAYQVEGAWDEDGKSPSIVDMLDHPEGTADFKVASDHYHRF
REDVKLFAELGLKAYRFSVAWTRVLPNGTGEVNAAGLAFYRQLIDELLGHGIEPVVTLYH
FDLPYVLEQQGGWSNRATIDAFVEYAAVLFDAFGDRVKYWLTINEQNTLILHPGAIGMPK
GGELPSKQVLYQQSHHMLVAQARVMALCHQRCPSGKIGPAINTTSMYQETCHPLDAIAAH
NWETLRCWSFLDVAVHGRYNALAWRYLRDRDLAPQMEPGDAALLLQGKPDYVAINYYSTA
TIAASRGDASDISARAGDQQIMLGEPGVYRAAENPFVGKTRYGWVIDPVGLRLTLRKTYE
RYALPILITENGIGAPDELQADGTINDDYRIEFMRQHVEQMQLAINDGVELMGYCPWAAI
DVVSTHQGYAKRYGFIYVNRGEQDLKDLRRIKKRSFDWYQRLIATHGRQR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaacgcctggacgatttccccgcagatttcctgtggggagcctctacctcc
gcctatcaggtggagggagcctgggatgaagacggtaaaagcccgtcgattgtagatatg
ctcgatcatcctgaaggaaccgccgatttcaaagttgccagcgatcactatcaccgtttc
cgcgaagacgtgaaactgttcgccgagctggggctgaaggcctaccgtttttccgtcgcc
tggacgcgggtgctgcccaacggcaccggtgaggttaacgccgccgggctggcattctac
cggcaactgatcgatgagctgctgggccacggcattgaacctgtggtgacgctttatcac
ttcgatttgccttacgtgcttgaacagcagggcggctggtccaatcgcgccactatcgat
gcgtttgtcgagtatgccgcggtgctgtttgacgcctttggcgatcgggtaaaatattgg
ctgaccatcaatgaacagaacaccctgatcctgcatccgggcgcgattggcatgccgaag
ggtggcgagttgccgtccaaacaggtgctgtatcagcaaagccaccacatgctggtggcg
caagccagggtgatggcgttgtgccaccaacgctgcccatccggcaaaatcggcccggcg
attaacaccacctcgatgtatcaggaaacctgccatccgctggacgccatcgccgcgcac
aactgggaaacgctgcgctgctggagtttcctcgacgtggcggtgcatgggcgctataac
gcactggcctggcgatatttgcgggatcgcgacctggcgccgcaaatggaaccgggcgat
gcggcgttgttgttgcagggcaaaccggattacgtggcgataaactactattccaccgct
accatcgccgccagtcggggcgatgcttcggacatcagtgcccgcgccggcgatcaacaa
atcatgctgggggaaccgggagtgtaccgagcggcggagaacccgttcgttggcaaaacc
cgttacggttgggtgatcgacccggtcgggttgcgcctgacactgcgcaaaacttacgaa
cgctacgctttgccgatattaatcactgaaaacggcataggcgccccagatgagttacag
gccgatggtacaattaatgatgactaccgcattgagtttatgcgtcagcacgttgaacag
atgcaactggcgatcaacgacggcgttgaactaatggggtattgcccgtgggcggcgata
gacgtggtcagcacccatcagggctacgccaagcgttacgggtttatctatgtaaaccgg
ggtgagcaggatctgaaagatctgcgccgcatcaaaaagcgcagttttgactggtatcaa
cggctgattgccactcatggccggcaacgctaa

DBGET integrated database retrieval system