KEGG   Serratia plymuthica AS9: SerAS9_2351Help
Entry
SerAS9_2351       CDS       T01503                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
srr  Serratia plymuthica AS9
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:srr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2525843..2527903
Genome map
AA seq 686 aa AA seqDB search
MNKFPPLSAKVPGLLHGADYNPEQWANYPGMVEKDVELMTQANCNIMSVGIFSWSKLEPE
EGKYQFAWLDEVLNKLYAQGIHVFLATPSGARPAWLSQKYPEVLRVGRNRVPALHGGRHN
HCLSSPVYRRKVNEINLALAQRYAHHPAVIGWHISNEYSGECHCSRCQSDFRDWLQQRYQ
TLDRLNEAWWSDFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFCSTQATDFCAQEIAP
LKAANPDLPATTNFMEYFYDYDYWQMSKVIDFISWDSYPMWHNRQDETGLACYTAMFHDL
MRSLKQGKPFVLMESTPSVTNWQPISKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHSGRLDTRVGKEVSELGRLLTAMAPVAGSRVEARVAIIFDWESRWAMDDA
QGPRNAGLHYEQTVVEHYRPFWEQGIAVDIINADCDLSGYKLVIAPMLYMVREGFAARAE
AFVRQGGQFVASYWSGIVDESDLCHLGGFPGPLRPLLGIWAEEIDSLTDDETNSIRGVPG
NELGLQGSYQARHLCELINLEGATAQAVYGGDFYAGRPALTVNRFGDGKAWYVASRNDAS
FQRDFFMAIAQQLALPRALDTVLPTSVTAQRRTDGESEFIIVQNYSDKAKTVALPAVYTD
MSNAKTLQGEMTLAPWGCRLLTRKLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttcctcctttgagtgcaaaggtgcctggcctattgcatggagcagactac
aacccggaacaatgggctaattatccgggcatggtggagaaagatgtagagctgatgacg
caggctaactgcaatattatgtcggtagggatattcagctggtcgaagcttgaacctgaa
gagggtaaatatcaattcgcgtggttggacgaggtgctgaataagttatatgcgcagggt
attcacgtatttttggctacgccaagcggcgcgcgtccggcgtggttgtcgcagaaatac
ccggaggtattacgcgtggggcgcaatcgggtacccgcgttgcacggtggccgacacaac
cattgcctgtcatccccggtgtatcgtcgcaaggtgaatgagatcaacctggcgttggct
cagcgctatgcgcaccacccggcggtgatcggctggcatatttccaacgaatacagcggc
gaatgccattgcagccgttgccagagcgatttccgcgattggttgcagcagcgttatcag
acgctggatcggttgaacgaggcctggtggagcgatttctggagccacacctacagtgat
tggtcgcagattgaatcgcccgcgccgcagggtgaggtgtcgattcacggtctgaacctg
gactggcggcgtttttgcagcacccaggccaccgatttctgcgcgcaggaaattgcgccg
ctgaaggcggccaatccagacttgccggccaccaccaactttatggaatatttctacgat
tacgattactggcagatgtcgaaagtcatcgatttcatctcctgggacagctacccgatg
tggcataaccggcaggacgaaaccggcctggcctgctataccgccatgttccacgatcta
atgcgcagcctgaaacagggcaagccttttgtgctgatggaatcgacgccgagcgtcacc
aactggcaaccgatcagcaagctgaagaaaccgggcatgcatattctctcctcactgcag
gcggttgcgcacggagcggattcggtgcagtacttccagtggcgcaaaagccgcggctcg
gtggagaaattccacggtgcggtgattgaccattccgggcggctggatacccgcgtcggc
aaggaggtgagcgagctgggtcggttgttgaccgccatggcaccggtcgccggtagccgg
gtcgaggcgcgggtggcgattatcttcgactgggaaagccgctgggcgatggacgatgcc
caagggccgcgcaacgccgggctgcattacgagcagacggtggtggagcattatcgtccg
ttctgggagcagggcatcgcggtggatatcatcaacgccgattgcgatctctctggttat
aaactggtgattgcgccaatgctgtatatggtgcgcgaaggttttgccgcgcgtgcggaa
gcctttgtccggcagggcgggcagtttgtcgccagctactggagcggcatcgtcgatgaa
agcgatctgtgccatctgggcggtttcccgggaccactgcggccgctgctggggatctgg
gcggaagagatcgacagcctgacggatgacgagaccaacagtattcgcggcgtgccgggc
aatgagctgggtttgcagggcagctatcaggcgcgccatctgtgcgagctgatcaacctg
gagggcgccaccgcgcaggcggtctacggcggtgatttttatgccggccgcccggcgttg
acggtcaaccgctttggcgacggcaaggcgtggtatgtcgcttcgcgcaacgatgcctca
ttccagcgtgatttctttatggcgatagcgcaacagctggcgttgccgcgcgcactggac
acggtattgccgacgagcgtaaccgcacagcggcgcaccgacggtgaatccgagttcatt
atcgtgcagaactacagcgacaaggcaaaaaccgtggcgttgccggcggtgtataccgat
atgtcgaatgccaagactctacagggcgaaatgacgttggccccctggggctgccgccta
ttgacccgcaagttggcctag

DBGET integrated database retrieval system