KEGG   Serratia plymuthica AS9: SerAS9_2583Help
Entry
SerAS9_2583       CDS       T01503                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
srr  Serratia plymuthica AS9
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SerAS9_2583
   00670 One carbon pool by folate
    SerAS9_2583
Enzymes [BR:srr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SerAS9_2583
    1.5.1.-  
     SerAS9_2583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2777700..2778422
Genome map
AA seq 240 aa AA seqDB search
MEHHNSAPVLITGGARRIGLALARSFLQRDIPVIIAYRSDYPALNELKRLGATCIQGDFS
THDGIYRFADRVRQAAPKLRAVIHNASAWLAESAEVPPEQIMAAMLQIHVYTPYLLNQLL
EPCLLGQGQAGADIIHLTDYVVEKGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNAIA
PALIIFNPGDDEPYRQQALAKSLMKIAPGESEVVNLVNYLLDSRYVTGRTHGVDGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcacaactccgcaccggtgctgatcacgggcggcgcacgccggattgggctg
gcattggccaggtcattcttgcagcgtgacatccccgtgatcattgcctatcgtagcgat
tacccggcactgaacgagctgaaaagactgggagcaacgtgcattcagggcgatttctcg
actcacgacggtatttaccgctttgccgatcgggtgcgccaggccgcaccgaaattgcgc
gcagtgatccacaacgccagcgcttggctggcagaatctgcggaggtgccgccggagcag
attatggccgcgatgctgcaaatccacgtttacaccccttatctgctcaatcagttgctg
gagccctgcctgcttggccaagggcaggcaggcgcagatattatccacctgaccgattat
gtggtggaaaaaggcagcgacaagcatatcgcttatgctgccagtaaagccgcgctggac
aacatgactcgctctttcgcccgtaaactggcaccggaggtcaaggtcaacgccatcgca
ccagcgttgattattttcaatccgggcgatgatgagccttatcgtcagcaggcgctggca
aagtcgctgatgaaaatcgccccgggtgaaagcgaagtggtcaatctggtcaattatttg
ctggacagtcgttatgtcaccggccgcacccatggtgtggacggaggacgtccactgcgc
tag

DBGET integrated database retrieval system