KEGG   Serratia plymuthica AS9: SerAS9_2665Help
Entry
SerAS9_2665       CDS       T01503                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
srr  Serratia plymuthica AS9
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SerAS9_2665
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SerAS9_2665
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SerAS9_2665
Enzymes [BR:srr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SerAS9_2665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
2868762..2869952
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQYVPQILMPALKQLEEAFVSAQRDPEFQAEFIDLLKNYAGRPTALTL
CKNLTAGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
ETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQMLEREGRLPDAVLACVGGGSNAIGMF
ADFIDDVSVGLIGVEPAGLGIETGQHGAPLKHGHVGIYFGMKAPMMQTSEGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRAEYVSITDDEALDAFKALSRSEGIIPALESSHALAHALKM
IRETPQKEQILVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcttaacccctacttcggcgaatttggtggccaatatgtgccgcagattctg
atgccggcattaaaacaactggaagaggccttcgtcagcgcacagcgcgaccctgaattc
caggctgagtttatcgatctgctgaaaaactacgcgggccgccctacggcgctgacgctg
tgcaaaaacctcaccgccggcaccaaaaccaagctgtacctgaagcgtgaagatttgctg
cacggcggcgcgcacaaaaccaaccaggtgctggggcaagcgttgctggccaagcgcatg
ggcaaaaccgaaatcatcgccgaaaccggtgctggccagcatggcgtggcctctgctctg
gcctgtgcattgctcggcctgaaatgccgcatctatatgggcgccaaagatattgaacgc
cagtcgccgaacgtgttccgcatgcgcctgatgggtgccgaagtgatcccggtgcacagc
ggttcctccacgctgaaagatgcctgcaacgaagcgctgcgcgactggtccggcagctat
gaaaccgctcactatatgctgggtaccgcagccggcccgcacccgtatccgaccatcgtg
cgtgagttccagcgcatgatcggcgaagaaaccaaggcgcagatgctggagcgcgaaggc
cgcctgccggacgccgttctggcgtgcgtcggcggtggttctaacgccatcggcatgttt
gccgactttatcgatgacgtcagcgttggcctgatcggcgtggaacctgccggtctcggt
atcgaaaccggccaacacggtgcgccactgaagcacggccacgtcggtatctatttcggt
atgaaagcgccgatgatgcagacctccgaaggccaaatcgaagaatcctattccatttcc
gccgggctggacttcccatccgtcgggccgcagcacgcctatctgaacagcattggccgt
gccgaatatgtatcgattaccgacgacgaagcgctggatgccttcaaggctttatcgcgc
agcgaaggcattatcccggcgctggaatcctcccatgccctggcgcacgcgcttaaaatg
atccgtgaaacgccgcagaaagaacagatcctggtggttaacctgtccggccgcggcgac
aaagacatatttaccgttcacgacatactgaaagctcggggagaaatctga

DBGET integrated database retrieval system