KEGG   Serratia plymuthica AS9: SerAS9_2755Help
Entry
SerAS9_2755       CDS       T01503                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
srr  Serratia plymuthica AS9
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:srr00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2955650..2956282
Genome map
AA seq 210 aa AA seqDB search
MKTALLLIDLQNDFCHGGALAVTDGDATVIAANQAIAACVARGEPVVACQDWHPANHRSF
AVNSGTEVNTQGELEGLPQVWWPVHCVQESPGAQLHPQLHRQAIAEVFRKGQNPDIDSYS
AFFDNGHRAQTALDSWLRAQGITHLAIMGLATDYCVKFSVLDALELGYVTSVITDGCRGV
NLQPGDSPKAFQAMELAGAQLVTLSQFIAH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagccctgttgttaatcgacttgcaaaatgatttttgccacggtggcgcgttg
gcggtgacggacggcgatgccaccgttatcgccgccaatcaggcgattgccgcctgcgtg
gcgcgcggtgaaccggtggtcgcttgccaggactggcaccccgccaatcaccgcagcttt
gcggtgaattcagggactgaggtcaacacgcaaggtgagctggaaggattgccgcaggtg
tggtggccggtgcactgcgtgcaggaaagcccaggggcgcaattgcatccgcagttgcac
cgacaggccattgccgaggtattccgtaaaggccaaaacccggatatcgacagctacagc
gccttttttgacaacggccaccgagcgcaaaccgcgctggacagttggctaagggcgcag
ggcatcactcatctggctatcatggggttggcgaccgattactgcgtgaagttcagcgtt
ctggatgcactggagctgggatatgtgacctcagtgattaccgacggctgccgcggcgtc
aatttacagccaggtgacagcccaaaagcgttccaggcaatggaattggccggagcacaa
ctcgttaccctgtcacaattcatcgcacattga

DBGET integrated database retrieval system