KEGG   Serratia plymuthica AS9: SerAS9_2870Help
Entry
SerAS9_2870       CDS       T01503                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
srr  Serratia plymuthica AS9
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:srr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SerAS9_2870
Enzymes [BR:srr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SerAS9_2870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3057268..3057882)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGYILEKQPPLVLLEANGVGYEVHMPMTCFYELPDLGQEAIVFTQFVVREDAQLL
YGFNDKQERALFRELVKVNGVGPKLALAILSGMSAQQFVSAVEREEITTLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNSSEITLPATATQAAELDAEAEAASALVALGYKPQEASR
MVSKIAKPGADCETLIRDALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgtctcagaggatatattctggaaaagcagccgccgctggtgttactggag
gcaaacggcgtgggttatgaagtgcatatgcccatgacctgcttttatgagctgccggat
ctggggcaagaagccatcgtgtttacccagtttgtggtgcgcgaagacgcgcagctgctg
tacggtttcaacgataaacaagagcgcgcactgttccgtgagttggttaaagtgaacggt
gtgggaccgaaactggcgctggctatcctgtccgggatgtccgcacagcagtttgtcagc
gcggtagagcgtgaagagatcaccacattggtgaaattgccgggcgtgggcaagaaaacc
gctgagcgcctggtggtcgaaatgaaagaccgctttaaagggcttaatggcgatctgttc
aataacagcagcgaaatcacgctgcccgctacggcaacgcaggcggccgagctggatgct
gaagcagaagccgcttctgcgctggtggcattaggctataaaccgcaggaagccagccgc
atggtcagcaaaatcgccaaaccgggcgccgattgcgaaaccctgatccgcgacgcgctg
cgcgccgccctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system